(data stored in ACNUC16935 zone)

EMBL: BN001307.PE121

BN001307.PE121       Location/Qualifiers
FT   CDS_pept        join(336946..337921,338491..339184,339596..339630,
FT                   339803..339992,340058..340145,340236..340589)
FT                   /locus_tag="ANIA_08949"
FT                   /old_locus_tag="AN8949.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007912"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007912"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007912"
FT                   /db_xref="GOA:Q5ARY1"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY1"
FT                   /protein_id="CBF84592.1"
FT                   /translation="MSTTSTPRHRPISFVGKWLDTIEERPAPQSTSYPRRSPIPSASSN
FT                   LTGSTLVWPRARQDTGITQDTRVVVVKSPRPKKSKKDAFCAIFRSWKATLTTRTTSHET
FT                   FPATVRENPELAIAELSSHLSANFAVLIETALRNSPSKALSARRICKEIMRADNWYRAH
FT                   ENLGWQESVARELSLSPSFQPVIECREGRVRNKGVKWQLTAVDVSLAPATAPWRPPQDS
FT                   VPYPLELSTEVEATERQTEPSRAENSDTPQPRRPSAGLPALAALASASLLSSALPLHPE
FT                   EDTIPKDEALVSGFSKRLFFTAPGPSRSPANISFNDAPPPSHQSDTPTVPPPLRPPPPS
FT                   LDIPESLPVQVDSSARPSPASSTALSADPLATADASSVQVSTPSSCAQQLYDSPLPITA
FT                   AVRVLKHNIHCIEKRLSLVENTTIQLLQKWEMPSGRGPNLIVPAHSLGSSIYSRCNPSN
FT                   GSMLSPGNYNPSFSQSNNSLSNCPPLGSSTAVTTRTPSEKAPSEEFPSPDFDVLLSFEN
FT                   PDNPRAGATNADDDGGLVEDRFMPDLDLEAWNEEHNGALGVLEKERLGTDNPTILEYSE
FT                   GSGPYFDETAANPWRLSSSNGAKQIQTTPNLSLNFYRPLQTTKRTRLQPTTWRMTSRIK
FT                   AVDINYYVLWYENILDTKAPNNQLDWVRDGRLVVSVWSTVEGQNAIVEAAIDNNLDMVQ
FT                   YPFSKGPDIDEVGIKGPAGDESYNDMGIPLHQAATDGYTEMALFLADAGANTHLKDPMG
FT                   RTAEDLALEKDHTEILTLYAGKRVP"
     atgagcacca ccagcacccc aagacatcga ccgatatcgt ttgtggggaa gtggctggat        60
     acgatagaag aaagaccggc accacagtcc actagctacc cccgccgcag ccctataccg       120
     tcggccagtt ccaacctcac cgggtccaca ctcgtttggc cacgcgcgcg gcaagatacc       180
     ggcatcactc aagacactcg tgtggtcgtc gtcaagtcgc cgcgccctaa aaagagcaaa       240
     aaagacgcct tctgcgccat cttccgcagc tggaaagcca cccttaccac gcggacgacg       300
     agccatgaaa ccttcccagc gaccgttcgc gaaaaccccg agctcgccat tgcagagctc       360
     agctcgcatc tgtctgccaa ctttgcagtc ttaatcgaga cggctctgcg gaacagcccg       420
     tcgaaagcgc tgtccgctcg ccgcatatgc aaggagatca tgcgagcgga taattggtac       480
     cgagcccacg agaatctcgg ctggcaggag agtgtcgcac gcgaactctc cttgagccct       540
     tcgttccagc cggtgatcga atgccgtgag ggtagggtta ggaacaaggg ggtgaagtgg       600
     caactcaccg cggtcgatgt ttctcttgca cctgcgactg ctccctggcg gccaccgcag       660
     gattcggttc cctatccact ggagctgtcg actgaagttg aagctaccga gaggcagacg       720
     gagccatctc gcgctgaaaa cagtgacacg ccgcaacctc gtcgtccgtc tgccggactg       780
     cctgccctag cggcacttgc ctctgcgtct ctactatcat cggcactgcc ccttcatcct       840
     gaggaagata caatcccgaa ggatgaggct ctggtatctg ggttttccaa gcggttgttc       900
     tttacggcac ctggtccttc tcgtagtccc gcgaacatat cattcaacga tgcgcctccg       960
     ccttcgcacc agtctgatac tccaacggtg ccgccgcctc tacggcctcc accacccagc      1020
     ctagacatcc ccgagtctct gccggtccaa gtggacagta gcgcacgccc aagcccagct      1080
     tcctcaactg cgctctcggc agaccccctg gccactgctg atgccagctc ggtgcaggtc      1140
     tctacaccca gcagctgcgc ccagcagctg tacgattccc ctcttcccat tactgcagca      1200
     gtgcgagttc ttaaacacaa cattcattgc attgagaaac ggctttcctt ggttgagaat      1260
     actacgatcc agctgttaca gaagtgggaa atgccgtcag gccgtggccc aaacctgata      1320
     gtccccgcgc actcacttgg gagctctata tattctcgct gcaatccttc caacggctcc      1380
     atgctttctc cgggcaatta taatccaagc ttctcccagt ctaacaactc tctgtcaaac      1440
     tgtcccccgc ttggctcgtc cacggccgta accactagga caccctcaga aaaggcacct      1500
     agtgaggaat tcccttcgcc ggatttcgat gtacttttgt ccttcgaaaa cccagataat      1560
     ccacgtgccg gtgcaaccaa cgccgatgat gatggcggcc tagtcgagga ccgctttatg      1620
     cccgacctgg acctcgaagc ctggaacgag gagcataacg gagcactcgg tgttttggag      1680
     aaggagagat tgggtacaga caatcccact atcttggagt acagtgaagg atccgggcca      1740
     tatttcgacg aaacagccgc gaacccttgg aggctttcat ccagcaacgg cgcgaaacag      1800
     atccagacta ctcccaacct ctccctgaac ttttacaggc cgctgcagac taccaagcgg      1860
     acaagattgc agcctactac ctggagaatg actagtcgaa taaaagcggt cgatatcaat      1920
     tactatgtgc tttggtatga aaatattctt gacacaaagg cccccaataa tcagcttgac      1980
     tgggttcgcg acggtagact tgttgtctcg gtatggagca cagttgaagg acagaatgca      2040
     attgttgagg cagcaattga taataactta gatatggtac aatatccctt ctcaaagggg      2100
     cctgatattg atgaagtcgg gatcaaaggc ccggcgggtg acgagtctta taatgatatg      2160
     ggaattcccc ttcatcaggc tgctacagat ggatacacag agatggcgct tttcttggcc      2220
     gatgcaggag ctaacaccca tcttaaggat cccatgggac gtaccgcaga agacctcgct      2280
     ctggaaaagg atcatacaga gatcctaacg ctctacgccg gaaaacgggt accatga         2337
//

If you have problems or comments...

PBIL Back to PBIL home page