(data stored in ACNUC16935 zone)

EMBL: BN001307.PE122

BN001307.PE122       Location/Qualifiers
FT   CDS_pept        join(341446..341463,341734..341798,341839..342193)
FT                   /locus_tag="ANIA_08948"
FT                   /old_locus_tag="AN8948.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007913"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007913"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007913"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY2"
FT                   /protein_id="CBF84594.1"
FT                   /translation="MRIPAVLAEYRLDLPRARNQAPGLQRLRVRIAVIDPMCTWMYPTD
FT                   ITVHLGSTRLAVYYAPGVSLGRGFALGGMIADSGDLLGCVSASCAGGWFEVRIGEGEKL
FT                   VTLISKFKEEITNSRLNALRLYSNFHLALVGSPRMRLGNKS"
     atgcgaatcc cagctgttct cgctgagtac cgtctggacc ttccccgcgc aagaaatcag        60
     gctcctggac tgcagcgcct gcgcgtgcgt atcgcagtga ttgacccgat gtgcacgtgg       120
     atgtatccga cagatattac tgtgcaccta ggctcgacgc gactggccgt ttactacgcg       180
     ccgggcgtct cactaggtcg gggttttgcg ctcggcggca tgattgcaga ctctggggac       240
     ttattgggat gcgtatcagc atcctgtgcc ggcggctggt tcgaggtgcg cataggagaa       300
     ggagagaagc tggttacctt gatcagcaag tttaaggagg aaatcaccaa ttccaggctc       360
     aatgcgctgc ggctgtattc taactttcac ctggcattgg taggaagccc gaggatgcgc       420
     ttaggaaaca agagttga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page