(data stored in ACNUC16935 zone)

EMBL: BN001307.PE127

BN001307.PE127       Location/Qualifiers
FT   CDS_pept        complement(join(355631..355772,356092..356250,
FT                   356322..356407,356580..356775,356834..357011,
FT                   357124..357277))
FT                   /locus_tag="ANIA_08944"
FT                   /old_locus_tag="AN8944.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007918"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007918"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007918"
FT                   /db_xref="GOA:Q5ARY6"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY6"
FT                   /protein_id="CBF84604.1"
FT                   /translation="MPTYPHSRTTETPQIACQAHYGLIGSVAQALNHYTVRPRCKEIVS
FT                   FNHTFPADLGDGSSPFDARNIDNAGDAEIRKHQACPHRRLFRLLEACGEWQPRFGSKVQ
FT                   STHGMSEAGFFAVPDPNEPVQDANMGIFVPNVEAKFLDESSDVLSLNEEGVYICTPFVR
FT                   KGYLDEPTHTAQAARPVTRSEIETAVSRHPGVRDVAVIPVVLPGSECPAPRAYIVKTYG
FT                   SSLLIEELISCMATKYLPRMQLTGGAAFVDAIEQIWVHGWGHRIEVQIPSLLQIEASII
FT                   PIVVIGVFYVRSERRCWCGLSEI"
     atgcctacct acccgcattc cagaacaacg gaaacacccc agatcgcatg ccaggcgcac        60
     tacggtctta tcggcagcgt cgcccaagct ctaaaccact acacagtccg gcctaggtgc       120
     aaggagatcg tctcgttcaa ccacacattc cccgccgact tgggtgatgg ctcctcccca       180
     tttgatgcgc gcaacattga caatgccggc gacgccgaaa ttcggaagca tcaagcatgt       240
     cctcacaggc gactctttcg tctcttggaa gcttgtggcg agtggcagcc gaggtttggg       300
     tcgaaggttc agagtacgca tgggatgtcc gaggcaggct tttttgcggt tcctgatccg       360
     aacgaacccg ttcaagatgc taatatgggg attttcgtgc cgaacgttga agccaagttc       420
     ctcgacgaga gtagcgacgt cttatctctg aacgaggagg gggtgtatat ttgtacacct       480
     tttgtgagaa agggatacct cgatgagccg acgcatacgg ctcaggcagc gcgaccggtt       540
     acaaggtctg agatcgagac cgcagtctcc cggcatccgg gcgtccgtga cgttgctgtt       600
     atccctgttg ttctgcccgg tagcgaatgc cctgcccctc gggcctacat tgttaagaca       660
     tacggctcga gcctgttaat agaggagctg atatcatgta tggcaaccaa atatcttccg       720
     cgcatgcagc tcaccggtgg tgctgcgttc gttgatgcta ttgaacaaat atgggtgcac       780
     gggtgggggc acaggattga ggttcagatt ccatcacttt tacagatcga ggcctccatc       840
     atccccattg tggtcatcgg ggtcttttat gtcaggagcg agagacgctg ctggtgtggt       900
     ttgtcggaga tttga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page