(data stored in ACNUC16935 zone)

EMBL: BN001307.PE128

BN001307.PE128       Location/Qualifiers
FT   CDS_pept        complement(join(359067..359575,359637..359701,
FT                   359770..360167,360248..360352,360408..360584))
FT                   /locus_tag="ANIA_08943"
FT                   /old_locus_tag="AN8943.4"
FT                   /product="integral membrane protein, putative
FT                   (AFU_orthologue; AFUA_6G11560)"
FT                   /note="transcript_id=CADANIAT00007919"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007919"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007919"
FT                   /db_xref="GOA:Q5ARY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY7"
FT                   /protein_id="CBF84606.1"
FT                   /translation="MSSGLNSDDSDGHVRELAVRSVAASFLSIATIAVSLRCYVRGWLI
FT                   KGFGWDDWAMVVAMAFYIMFSACMIGGSIYGTGHRFAALEPQNRVTAMRYWWLCEIAYC
FT                   FSSVGCKISVCIFLMRITIKRIHIWILYIVMALTVLTGLVFMFIMLLQCKPLEYFWTRT
FT                   AFDPDVKGYCIDIQIVIAMTYVYSAFAALCDFTVGTLPIFLVSKLQMRKKTKLAVVGIL
FT                   SMACIASSAVIVRIPFVKTFADPDFLYATIEIAIWSNIEIGLGITAGSLATLRPLLRHW
FT                   MGSTNDPSYPLGTPSPFPGRSGSRLPGASGRDRAYPLGSMDDSNRLRPDKLALTVTTVQ
FT                   TQHDPEDRWPVLPDGNSSEERLTNEHQRNGKGNGNRTPTRSSAERNVMGSGFGGIHQVI
FT                   EVTQTSTDLRSTSVKEHV"
     atgtcctcgg gcctcaacag tgatgattcg gacggccacg tccgcgagct agccgtcagg        60
     tcggttgcgg cctctttcct aagcattgcc accatcgctg tgtctttacg ttgctatgtc       120
     cggggctggt tgatcaaggg ctttggatgg gacgattggg cgatggttgt tgcgatggcc       180
     ttttatatta tgtttagcgc gtgcatgatt ggcggctcta tatacgggac agggcacaga       240
     ttcgctgcct tagaaccgca gaatcgcgtg acagccatgc ggtactggtg gctctgcgaa       300
     atcgcttact gcttttcctc cgtcgggtgc aagatctccg tctgcatctt ccttatgcgc       360
     atcacaatca agcgcatcca tatctggatt ctctatatcg tcatggccct caccgtgcta       420
     acgggattgg tcttcatgtt catcatgctg ctgcagtgca agccgctcga gtatttctgg       480
     acccggacag catttgatcc ggacgtcaaa ggctactgca tcgatatcca gatcgtcatc       540
     gccatgacct atgtgtatag cgcgtttgcg gcgctgtgtg atttcaccgt gggaactctg       600
     ccgatcttcc tcgtcagcaa gttgcaaatg cgcaagaaga ctaagctggc tgttgtgggc       660
     attctgagta tggcttgcat tgcctcctcc gctgtcatcg tccgtatccc ctttgtcaag       720
     actttcgctg atcctgactt tctctatgcc acaattgaaa tagcaatctg gtccaacatc       780
     gaaattggcc tcggtatcac cgccggttcg cttgcaaccc tccgcccgct cctgcgtcac       840
     tggatgggct ctacgaacga tccctcttat ccactgggca caccttcccc attcccgggt       900
     cgctccggat cgcgtctccc tggtgcctca ggtcgagacc gagcatatcc gctcggctcg       960
     atggacgaca gcaaccgatt acggccagac aaactcgccc ttacggttac gactgtgcag      1020
     acacagcacg atcccgagga tcgctggcct gtcctgcctg atggaaatag tagtgaagag      1080
     cggttgacca atgagcatca gcggaatggc aaggggaatg ggaataggac gccgacgaga      1140
     tcgagtgcag agcgaaacgt gatgggatct ggttttgggg ggattcacca ggtcattgag      1200
     gttacgcaaa cgtcgacaga tttgaggtca acgagtgtga aggagcatgt ttag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page