(data stored in ACNUC16935 zone)

EMBL: BN001307.PE129

BN001307.PE129       Location/Qualifiers
FT   CDS_pept        join(364679..365405,365445..365533)
FT                   /locus_tag="ANIA_08942"
FT                   /old_locus_tag="AN8942.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007920"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007920"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007920"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY8"
FT                   /protein_id="CBF84608.1"
FT                   /translation="MATPPASITFYDIAMRTPSLSCSPNPSKTRLALNFASVPYKTTFV
FT                   PLPSIPSVRQSLGVPAGRQFADGSDFYTLPVIVDEVTGSKIGDSFDIAIYLHERYADAN
FT                   GGKGELFPILKNGEKLDFRTPNTAMLVPLSAMSEVARQDKYLEYATFNTHVDAAFTLHV
FT                   LLTVHGLPFPPDTAEATRAEFCKRAGVPSWDAFTVSGEAREKLKESLKETLAELAKLFV
FT                   RNEDGPFILGGKPCYADFIVDEWEEVRGWHGGVFGRVFDALSVYMEVKE"
     atggccactc cccccgcctc aataacgttc tacgacattg ctatgcgcac tccatcgcta        60
     tcctgctctc cgaacccctc aaagacccgg ctcgccctga acttcgcgtc cgtcccctac       120
     aaaaccacct ttgttccgct cccctccatc ccctccgtcc gccaatctct cggcgtcccc       180
     gccggccgtc agtttgccga cggaagcgac ttctacaccc tccctgtaat tgtggacgaa       240
     gtgacgggct caaaaattgg ggactcgttc gatatcgcaa tttacctgca tgagaggtac       300
     gcggatgcga atgggggcaa gggagagttg ttcccgatat tgaagaatgg ggagaaattg       360
     gattttagga ctcccaatac ggctatgctt gttcccttat ctgctatgag cgaggttgcg       420
     agacaggaca agtatttgga gtatgcgacc ttcaataccc acgtcgatgc ggcgttcacc       480
     ttgcatgtcc tgttaacggt ccacggctta cccttcccgc ccgacacggc ggaagctacc       540
     agagccgagt tctgtaagcg tgctggtgtg ccgtcgtggg atgcgttcac tgtctctggt       600
     gaagctcgcg agaagctcaa ggagtcgctc aaggagacgt tagcagagtt ggcgaagtta       660
     tttgtccgaa atgaggatgg gccatttatt ttggggggga agccctgcta tgcggatttc       720
     atcgtcgatg agtgggagga ggttcgaggg tggcatgggg gtgtttttgg gagagtgttt       780
     gatgcattat cggtgtatat ggaggttaaa gaataa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page