(data stored in ACNUC16935 zone)

EMBL: BN001307.PE13

BN001307.PE13        Location/Qualifiers
FT   CDS_pept        complement(join(39033..39247,39301..39415,39464..39665,
FT                   39727..40420,40535..40731,40779..41414,41463..42587,
FT                   42654..42779,42998..43017))
FT                   /locus_tag="ANIA_09048"
FT                   /old_locus_tag="AN9048.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007805"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007805"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007805"
FT                   /db_xref="GOA:Q5ARN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN2"
FT                   /protein_id="CBF84393.1"
FT                   /translation="MALALEDSLWNPTVLSPELILSMQEYLSPALRQPPLPDSEKKRLR
FT                   ELSRYYCAIRPSSVPQDPDATLTQSEPENEPGLNVAQLPSDITLTALTQLGVHRLGCER
FT                   SFASLIDGHSQYIISEATASISLRDREKHSPNDGLYLGNTTLDLVWGVCPHAIKLFSGY
FT                   DVPHLKNTANVTANPTRYIVRDFTQEDCFKDRPYVTGWPHMRFYAEVPIYSPSGHILGG
FT                   YCVVDNKPRQDFSEDEVIALQEISDAIARHLENVRTVHYHRRSDRLIQGLTTFVKDRLH
FT                   ERSPLDAPAPPRAAETPSLERLGLDELPSSTEVTGGTSLLFSTQNAARKSTHATSLSGT
FT                   LHKAVSSPLLNEVVTDTGPSQDTVPLRMNDNSSAKSTPKPVAKDKVPFLRRIENIYAYA
FT                   SSLIRESMDLDGVMFVDASRCNSGSVSLKADMLNWEPLPKNADPRPRSQYSNSAVADET
FT                   ICDTLGLASNETDTQHGIPDSLLRELIAAFPQGGVLLPDADNDNSQLPETRLAKSFPEA
FT                   KSLLFIPLWDWNKGQWLAGTFVWTKDSEQERALGVDELHYFKVFGDSIISEIARLDWSL
FT                   KEKSKFGLISSVSHEIRSPLHGMLANAELLSSSPLQPEQQQTVKALEMCGITLLDTMNH
FT                   LLDFAKINNLASINQTASSVTSLLTSFDLDVLIEEVVSSVFSGMCHAAIALTPPESPSN
FT                   PDTAYKQDSGFVEISVSLLDPPVKTDPDSAVAHLRFTDTGCGMSQEFLRNKLYSPFAQE
FT                   DALAEGAGLGLSIVKQLVSFFKGSIDVKSEIDVGTQVDIQIPVQLAPDDFATGAFGPEL
FT                   GMGLRETTFSLIGLDAYPELSEEPTGSLSSEAKRRICLQSFFTNLLSGKPNWKISSTAT
FT                   LAEADGEIAIVSEAALKQLFVDESLRRRAEKNQTKFVCLCDGLPTLNANGPGGAQVIRL
FT                   YQPYSPRKVLQAIESVMQAKPQPFAGADDQSPPVSKATPPTNPTNDSAPPASGTHGNKV
FT                   LIVDDNEINLKVLARLMSKLGYQHTTATNGLVAFTKYKESPNSFSMVLMDISMPVMDGI
FT                   DATRNIRSYEWEKQLSSVKVFAVTGIGSAAMQHEALMAGVDEYLVKPLSLGQLGKLMKV
FT                   HL"
     atggctctgg ccctggaaga ctccttgtgg aatccaaccg tcttatcccc tgagctcata        60
     ctgagcatgc aggaatacct ctcaccagcg cttcggcaac caccattgcc tgactcggag       120
     aagaagcgat tgcgcgaact gtccaggtat tactgtgcca tccgcccgtc ctccgtacct       180
     caagatcctg acgcaacgtt gactcagagt gagcccgaga acgaacccgg tctcaatgtc       240
     gcccaacttc cgtctgatat caccttgacc gctcttacgc agctcggcgt gcatcgactt       300
     gggtgcgagc ggtcgtttgc ctcgctcatt gacggacaca gccagtatat catttccgaa       360
     gcgaccgcgt ccatctcatt gcgggacagg gaaaaacatt cgcccaacga tggcttgtat       420
     cttgggaaca ccacgttaga cctggtctgg ggagtgtgtc ctcatgccat caagctgttc       480
     tccggatacg atgtaccgca cttgaagaat acggccaacg ttaccgcgaa cccgacccgc       540
     tacatcgtcc gcgatttcac gcaggaggat tgttttaagg atcgtcctta tgtgacaggc       600
     tggccgcaca tgcgattcta cgccgaggtc ccgatatata gtccgtctgg tcacattctc       660
     ggtggttatt gtgtggtcga caataagccg cggcaggatt tcagcgagga tgaagtgatc       720
     gctttgcagg agatctcaga tgcgatcgcg cgtcatcttg agaatgtccg aacagtccat       780
     taccatcgac ggtcggaccg cctcattcaa gggctgacca cctttgtcaa ggaccgtctc       840
     cacgaacgaa gtccgcttga cgctccagcg ccgccgcgcg ctgcagaaac accgtctctg       900
     gagcgactcg gtctagacga attgccgtcg agtactgagg taactggagg aacgtcgctg       960
     ctattttcta cccaaaatgc tgccagaaaa tctactcacg cgacgtcgct atctggcaca      1020
     ctgcataagg ccgtgagctc gccgctgctg aacgaggttg ttaccgatac tggcccgtct      1080
     caagacactg ttcctttgcg tatgaatgac aactcgagtg caaagagcac tccaaagccg      1140
     gtcgcgaaag acaaagttcc atttttgagg cgcattgaaa acatttatgc ttatgccagc      1200
     tccctaataa gggagtcaat ggatcttgac ggagttatgt ttgtagacgc ctctcggtgc      1260
     aattctggaa gtgtctcgct gaaagcagat atgctgaact gggaaccatt acccaaaaac      1320
     gcggatcctc gaccaagaag tcagtattct aacagtgccg tggcggacga aaccatatgc      1380
     gacacacttg gcctggcctc gaacgagact gacacccaac atgggatacc tgactcgctt      1440
     ctacgggagc taatcgccgc cttccctcaa ggtggtgtct tgcttccaga cgctgacaac      1500
     gataattctc aactacccga aacccggctc gcaaaatcat ttcccgaagc aaagtcattg      1560
     ctttttatcc ccctctggga ttggaacaag ggacaatggc tcgctgggac gtttgtgtgg      1620
     acgaaagata gcgagcagga gcgggcgctc ggagttgatg aattacacta ttttaaagtc      1680
     tttggtgact cgataatatc tgaaattgcg aggctcgact ggtctttgaa ggagaaatcc      1740
     aaattcggcc ttatttcttc cgtcagccat gagattcgat caccgttaca tggaatgctc      1800
     gcgaatgcgg aactcctatc atcttctcct ttgcagccag agcagcagca aacggtgaag      1860
     gcgctggaaa tgtgcggtat tactttgctg gatacgatga accatcttct ggactttgca      1920
     aaaatcaaca acctcgcttc cattaatcag actgcctcgt cagtcaccag tctacttacc      1980
     tcgttcgacc ttgacgtcct gattgaggaa gtagttagca gtgtcttttc cggaatgtgc      2040
     catgcggcca ttgcgttaac gcctccggag agtcctagca accccgacac tgcctacaaa      2100
     caggacagtg gttttgttga aatctcggtg tcgctgctgg atccgccagt gaaaaccgac      2160
     ccagattctg ccgttgcaca cttgcgcttc actgataccg ggtgtggaat gtctcaggaa      2220
     ttcctgagga ataagctgta ttcgcctttc gcgcaagagg acgccctagc cgaaggtgct      2280
     ggccttggtc tgagcattgt gaagcaactt gtctcttttt tcaaggggtc aatagacgtg      2340
     aagagcgaga ttgatgttgg aactcaagtt gatatccaaa tccccgtcca actggccccc      2400
     gatgatttcg ctacaggtgc atttggtccg gaattaggca tgggtttgcg ggaaaccaca      2460
     ttctctctca tcggccttga tgcgtaccct gaactttccg aagagcctac tggaagcttg      2520
     agctcagaag cgaagcgaag aatttgctta cagagcttct ttaccaacct actttccggg      2580
     aagcccaatt ggaagatctc ctcgacagcc acgttggccg aggcagacgg cgagattgca      2640
     attgtcagcg aagccgctct gaaacaactc ttcgtagacg agtcactgcg tcgtcgtgcg      2700
     gagaagaatc agactaaatt tgtatgtctt tgtgatggct tgccgactct aaacgcgaat      2760
     ggacctggcg gggcccaggt tatccggcta taccaaccat actccccgag aaaggtgcta      2820
     caggctatcg agtcagtcat gcaggccaag ccccagcctt ttgccggtgc cgacgaccag      2880
     tctccgccgg tatccaaagc cacccccccg accaacccta ccaatgactc tgcccctcca      2940
     gccagtggta ctcatgggaa taaggtgctg atagtagacg acaatgaaat aaacctcaag      3000
     gttctcgcta ggttaatgtc taaactgggt tatcagcata cgacggcgac taatgggctt      3060
     gtcgcattca ctaaatataa agaatcgcct aactcattca gcatggtatt aatggatata      3120
     tccatgcctg ttatggatgg catagatgcc actagaaaca tccggtcgta tgaatgggaa      3180
     aagcagttat cttccgtcaa agtcttcgcc gtgactggta ttgggtctgc tgcgatgcag      3240
     cacgaagccc tgatggccgg agtggacgag tatctcgtga agccgctgtc actcggtcaa      3300
     ctagggaaac tcatgaaggt ccatttataa                                       3330
//

If you have problems or comments...

PBIL Back to PBIL home page