(data stored in ACNUC16935 zone)

EMBL: BN001307.PE131

BN001307.PE131       Location/Qualifiers
FT   CDS_pept        371651..373759
FT                   /locus_tag="ANIA_08940"
FT                   /old_locus_tag="AN8940.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007922"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007922"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007922"
FT                   /db_xref="GOA:Q5ARZ0"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ0"
FT                   /protein_id="CBF84611.1"
FT                   /translation="MANQESSTLVGCLFDVSGSMRKLLKTGQPDGRAVDRFHAVLGAAL
FT                   DIARKEQQSDPRAKMFVGAFGLDRQDGYPPTVDLCGIVEALLEENDQDDRSGHDSLIEI
FT                   ANQNNLAHITEYIRNKLTDSVARIVHACLRRCPERIHEFKDAIPSAAEIRKSQTMKNGA
FT                   TFGGGAVAIGVGSLVCGPLGGLLGAALTAGGAMSADAYADEVVDSSEGLMLARRICREW
FT                   FRDFADFIPRPVSDVVRLLQLLQQRSTRARQWLSVEEFVYGDTPMREALSRSLSVFQAN
FT                   SDCDQRVLVLMSDGHATDGDPGEIATELHSEGVAVASVYLTSDTDIAQRRLYDKPAYSW
FT                   DKGQRTLFNIASKVSASNHPIPVLMSVGWQIPCSGEVALYVCVCTEPAVEEFCSLLVSA
FT                   HLASTDALLDVIGRLQLDDYIQDELAITCKNPSDQGSSATCYAHAIAAVIHMALLRIER
FT                   KEPCPTIKEIRDRILHEFPPGDHGRVAEEVLNQAVQWYRLRYRAVDEMRARQAVLQRRP
FT                   VLTTFRLSEKGWAKFSQYFSQPQTRRSMLTEANMRPYRQGPDGGGHAVVLYACDPRSLS
FT                   FLNSWGSDWGTNGGFRVQSPAVLEIDEPDCLSPVHFYDVFWYESDLTPSERAAYDAKAE
FT                   EKLRAYTTYHPSLLELEAMCPLCQRISLISDFTGNAREAKCPRCLFSFVPQPGSLLQVL
FT                   YARAGLGT"
     atggcaaacc aagaatcatc cacgctggtc ggttgtctat tcgatgtgtc gggatcgatg        60
     cggaagctgc tcaagacagg gcagccggac gggcgcgcgg ttgatcgctt ccatgctgtg       120
     ctgggcgcag cccttgacat tgcccgcaag gagcaacaaa gtgatcccag ggctaaaatg       180
     tttgtaggcg catttggact tgatcgccag gacggttatc ctccaactgt ggacctctgc       240
     ggcattgttg aagctcttct agaagagaat gatcaagatg atcgcagcgg ccatgattcg       300
     ctcatcgaga tcgcgaatca gaacaaccta gctcatataa cagagtacat ccggaacaag       360
     cttacagaca gtgtagcgcg cattgtccac gcgtgccttc gtcgatgtcc ggagcgaatt       420
     cacgagttca aagacgcaat accaagtgcg gctgagattc ggaagtccca gacgatgaag       480
     aatggagcaa cgtttggtgg cggcgccgtg gcgattggtg ttgggtctct agtatgtggt       540
     ccattagggg gcttacttgg cgctgctctg acagcggggg gagcaatgag tgccgatgca       600
     tatgcagacg aggtagtcga ctcctcagaa ggtctgatgc tcgcgcgtcg catttgcaga       660
     gagtggttcc gagactttgc ggacttcatc cctcggccag tgagtgatgt ggtacgattg       720
     ttgcaactgc ttcagcagcg ttccacaagg gctcgacagt ggctatctgt tgaagagttc       780
     gtatacggtg acaccccaat gcgtgaggct ctgagccggt cattatccgt attccaagcg       840
     aattccgatt gtgaccagcg agttctcgtg ctgatgtcag atggccatgc aacagacggt       900
     gatcctggcg agatcgcaac tgagctacat tcggagggtg tcgctgtggc aagtgtgtac       960
     ctgacgagtg atactgacat tgctcaacga cgcttatacg ataaaccagc ctactcttgg      1020
     gataagggtc agcgtacact cttcaacata gcgtccaagg tttctgccag taatcacccc      1080
     attccggtgt tgatgtcggt gggctggcaa attccgtgct ctggggaagt ggccttgtat      1140
     gtctgcgtct gtactgagcc tgcagttgaa gaattctgct cgctgctagt atcggcgcat      1200
     cttgcgtcca cggacgcgct gctggacgtt ataggccgat tacagctgga cgattatatt      1260
     caggacgagc ttgcaattac ttgcaagaac ccatcagacc agggcagttc tgcaacttgc      1320
     tatgcgcatg ccattgctgc tgtgatacac atggcgctgt tacgcataga gcgcaaggag      1380
     ccctgtccga caattaaaga aatccgtgac aggattttac atgaatttcc cccaggcgat      1440
     catgggcgtg tggctgaaga ggtcctaaac caagccgttc agtggtatcg ccttcgttac      1500
     cgagcagtgg acgaaatgag ggcccggcag gcagtgctgc agcggcgtcc cgtactgact      1560
     acatttcgcc tctcagagaa aggttgggca aaattctccc aatatttcag tcaacctcag      1620
     acacggagat ccatgctcac cgaggccaac atgcgaccgt atcgtcaggg tcccgatggt      1680
     ggcggacacg ctgtcgtctt atatgcctgt gacccccgct ctttgtcatt ccttaactcc      1740
     tggggcagcg attggggcac gaatgggggc tttcgagtgc agagtcctgc agtgctcgag      1800
     atagacgagc cggattgttt gtctcccgtc cacttttatg acgttttctg gtacgaaagc      1860
     gacttaactc caagcgagcg agcggcctac gacgcaaaag cggaagagaa gctccgtgcc      1920
     tatacaacat atcacccgag tctccttgag cttgaggcga tgtgcccact ttgccaaagg      1980
     atctcattaa tctcagactt caccggcaac gcacgtgaag caaaatgtcc acgttgttta      2040
     ttctcatttg tcccgcagcc tgggagcctt cttcaagtgc tgtatgcccg tgcaggctta      2100
     ggcacgtag                                                              2109
//

If you have problems or comments...

PBIL Back to PBIL home page