(data stored in ACNUC16935 zone)

EMBL: BN001307.PE132

BN001307.PE132       Location/Qualifiers
FT   CDS_pept        join(375270..375462,375543..376420)
FT                   /locus_tag="ANIA_08939"
FT                   /old_locus_tag="AN8939.4"
FT                   /product="PHD finger protein (AFU_orthologue;
FT                   AFUA_6G13765)"
FT                   /note="transcript_id=CADANIAT00007923"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007923"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007923"
FT                   /db_xref="GOA:Q5ARZ1"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ1"
FT                   /protein_id="CBF84613.1"
FT                   /translation="MPSRKGQPRTLAKATGAERRQRTRRSLPVIPATPQAEPETWERTV
FT                   AEIAQEPMDLHVKKYREWKRNGSPHDTACRVCGATGNSDLKPGRLINCHTCRVAFHFIC
FT                   VPDGSEWATREGLYCPICVKRGWDMSPPGLSPPTSPVPAPAPIERPKGVAPIESAVTAA
FT                   VPREGPNTDSTNGPKPPQAASEGASFGNSSERIPQSPAVTARAESMRHDEDNNSDPEAP
FT                   QPKRQRTSRFVTLPSDVDASLGVIYRELESVASLKLQIQELQYKDRQSAQMIKLRDNSI
FT                   AILRRDLEKYRADDSELARLRDSAARFDQVKREMEELKRKNEMLGAELRKSREETATAQ
FT                   SLVNDWKGKLAQLLNA"
     atgccttcgc gtaaaggcca acctcgaact cttgcaaaag caactggagc tgaacgtcgc        60
     caaaggacgc gtcgtagtct tccggtgata ccggcgacac cccaggctga accagaaaca       120
     tgggagcgta cagttgccga aatagctcaa gagccaatgg atttacacgt caagaaatac       180
     agagagtgga agcgaaatgg atctccccat gacacggcct gtcgcgtctg tggagcgact       240
     ggcaatagtg acctcaagcc tggtcgactc ataaattgcc atacctgcag ggtagccttt       300
     catttcatct gcgtgccaga cgggagcgag tgggcgacca gggaaggtct ttactgtcca       360
     atatgcgtca agcgcggttg ggacatgtct cctccaggcc tctcgccgcc tacttcccct       420
     gtaccagctc ccgcgcctat tgagcggccc aagggtgtag cgccgatcga atccgccgtt       480
     accgctgctg ttcccaggga aggaccaaat actgactcaa ccaatggtcc caaaccgccg       540
     caagcggctt cagagggcgc ctcttttggt aacagctcag agcgcattcc acagtcaccg       600
     gctgtgactg cacgcgctga aagtatgcgg catgatgagg acaacaattc cgacccagaa       660
     gccccccaac ccaagcgcca acgtacatcg cggtttgtta ctctacctag cgatgtcgat       720
     gcctctctcg gcgtgatcta tcgagagctg gaatctgttg catctcttaa actacagatt       780
     caagagttgc agtacaaaga cagacaaagc gcgcagatga tcaagctgcg cgataatagc       840
     atcgcaattc tgcgccgcga tctcgagaag taccgcgcag atgatagtga gctggctcgg       900
     ctaagagaca gtgcagcacg attcgaccaa gtgaagagag agatggaaga actgaagagg       960
     aagaatgaga tgcttggggc ggaattaaga aagtccagag aggagaccgc gacggcacag      1020
     agccttgtaa acgattggaa ggggaagctt gcacagttgc tcaatgcttg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page