(data stored in ACNUC16935 zone)

EMBL: BN001307.PE134

BN001307.PE134       Location/Qualifiers
FT   CDS_pept        complement(join(379530..379554,379593..379636,
FT                   379666..380160))
FT                   /locus_tag="ANIA_08937"
FT                   /old_locus_tag="AN8937.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007925"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007925"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007925"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ3"
FT                   /protein_id="CBF84617.1"
FT                   /translation="MPQENGTNNGTPAFLSTQPGPNHDWRITLKDKVIVITGANRGIGL
FT                   AIAEVCLANEAAAVYSLDLFEPGEEFTAVQKKSANPSRLQYIHCDVTSEESISSAIDAV
FT                   VSASGAVHGFVANAGMTKHQPALDFTRAEIDKLFNLNVFGAYFCATAVARKFIELGIKG
FT                   SITQPRSAERTLWRYEGGRTMVFA"
     atgcctcagg aaaacggaac aaacaacggc acgccggcct tcctcagtac tcagcccggc        60
     ccgaaccatg actggcgaat caccctgaag gataaggtta ttgtcatcac cggcgcaaac       120
     aggggcatcg gtctggccat cgccgaggtc tgtctggcca acgaagccgc agctgtttac       180
     agcctagacc ttttcgagcc tggcgaggaa ttcaccgctg tgcaaaaaaa gtcagcgaat       240
     ccgagtcgcc tccaatacat ccactgcgac gtcacatccg aggaaagcat cagctcggca       300
     atcgacgctg tggtgtccgc cagtggcgcc gtccacggct tcgttgccaa tgctggaatg       360
     accaagcacc aaccagccct ggacttcacc cgggccgaaa tcgacaagtt gttcaacctg       420
     aacgtgtttg gcgcgtactt ctgtgcaacg gcagttgcgc gcaaattcat tgagctcggg       480
     atcaagggct ctattaccca accgcgcagc gccgagcgca ccctatggcg ctacgaaggt       540
     gggcgcacca tggtattcgc gtga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page