(data stored in ACNUC16935 zone)

EMBL: BN001307.PE135

BN001307.PE135       Location/Qualifiers
FT   CDS_pept        join(380593..380851,380897..381480,381526..381615,
FT                   381685..382104,382279..382323)
FT                   /locus_tag="ANIA_08936"
FT                   /old_locus_tag="AN8936.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007926"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007926"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007926"
FT                   /db_xref="GOA:Q5ARZ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ4"
FT                   /protein_id="CBF84619.1"
FT                   /translation="MDAKDLDEYHNGESNHIEASQEIFWTEEEEEKLVRKIDLFLLPNI
FT                   WIMYLLSYMDRTNIGNAKVAGMSDDLGLTSSQYSIVLVVFFIGYVVFEPPSNMILVRSR
FT                   PSLYLPAIMCLWGILTCVMSVVQHYHHLIVLRVFIGIVEAGFAPGILLIISSWYKRKEQ
FT                   SRRFAVFISAAILSGAFGGLIAGGITDGLEGVHGIRGWRWLFIVEGAATAGWAIISKFL
FT                   LLDYPGTSKRLTEREKAIAAARLQEGVIARGADERIGKLQGFCMACKDWRTWGFTIGYM
FT                   VIVGSSTLTYFYPTLVSGLGYTGRMAQYMTVPIYAVAFACTMITSVISDKLPTYRGLII
FT                   ASWLTVSMVTSIIVCAVYDFTTRYALLVIMAAGLWVSNATSLSFASSSFGSMDPEVRAQ
FT                   SLALMNALGNLAQIYGAYLFPSDDEPKYLMGFGVISGMLGVGVATYILMFALCRETVFA
FT                   ISDYLVR"
     atggatgcca aggatcttga cgagtatcac aatggcgagt ctaatcacat cgaggccagt        60
     caagagatct tctggacgga agaggaggag gagaagctcg tccgcaagat cgacctcttc       120
     ctgttaccga atatctggat catgtacttg ctctcttaca tggacaggac caatattgga       180
     aatgccaaag ttgcaggcat gtctgatgat ctgggtctca cgtcttctca gtatagcatc       240
     gtcctcgttg ttttctttat tggctatgtc gtcttcgagc cgccgtccaa tatgattctt       300
     gttcgatctc gaccgtccct ctatctccca gcaatcatgt gcctctgggg cattctgaca       360
     tgcgtcatgt cggtcgtcca gcactaccat catcttatcg ttctccgggt cttcatcggt       420
     atagtggaag ccggcttcgc ccctggtatt ctactgatca tttcctcctg gtacaaacgg       480
     aaggaacagt ccaggcgctt tgccgtattc atatcggcgg ctattctctc cggagcattt       540
     ggcgggctca tcgcaggggg gatcactgac ggtctcgagg gtgtccacgg aattcgcggt       600
     tggcggtggc tgttcatcgt cgagggcgca gctaccgcag ggtgggcgat catttcgaaa       660
     ttcctgcttc tcgattaccc aggaacctcg aaaaggctga cggagcggga aaaagccatt       720
     gctgctgccc ggctgcagga aggcgtcatt gccaggggcg ctgatgagcg tatcggaaag       780
     ctacagggat tttgtatggc ctgcaaagac tggagaacgt ggggattcac tatcggctac       840
     atggtcatcg ttggctcctc aaccctaacc tacttctacc cgaccctggt ctctggcctc       900
     gggtacactg gccggatggc gcaatacatg actgtcccaa tttacgccgt tgcctttgcc       960
     tgcacaatga tcacgagtgt cattagcgac aaactcccga cataccgtgg cctcatcata      1020
     gccagctggc tgaccgtctc catggtgacc tccatcatcg tctgcgccgt ctacgatttc      1080
     acaacgcggt atgccctcct cgtcattatg gctgcaggac tatgggtgtc caacgcaacc      1140
     tcgctaagtt ttgcctcctc gtcattcggc tccatggatc ccgaagtgcg cgcacagtcg      1200
     ctggctctca tgaacgcgct aggcaatctg gcgcaaattt acggcgctta tctcttccct      1260
     tctgacgacg agccaaaata tctcatgggc tttggcgtta tctctggaat gttaggtgtt      1320
     ggtgttgcta cgtatattct tatgtttgct ctttgtaggg agactgtttt tgctatttct      1380
     gactatcttg ttcgatag                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page