(data stored in ACNUC16935 zone)

EMBL: BN001307.PE136

BN001307.PE136       Location/Qualifiers
FT   CDS_pept        complement(join(383271..384292,384362..384712,
FT                   384765..385247,385315..385424,385487..385680))
FT                   /locus_tag="ANIA_08935"
FT                   /old_locus_tag="AN8935.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007927"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007927"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007927"
FT                   /db_xref="GOA:Q5ARZ5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ5"
FT                   /protein_id="CBF84621.1"
FT                   /translation="MAPGLELLPKTTALPTKAANAINNAVYGRDSDVKFESAEKHQRVL
FT                   NVFRAFIADLVQQYGDGHPGAPMGMAAIGIALWKYVMKYSPTNCNYFNRDRFVLSNGHA
FT                   CLWQYLFMHLVGVKSMTLEQLKSYHSTDSSSLCPGHPEIENEGVEVTTGPLGQGVANAV
FT                   GLAMATKNLAATYNKPGYEVVNNMTWCMVGDACLQEGVGLEALSLAGHWRLNNLCVIFD
FT                   NNNVTCDGTADVANTEDINTKMRATGFKVIDVYDGDSDVVAITNALLAARSSTKPTFIN
FT                   IRTTIGVGSKQAGTADAHGAALGVDEVAKIKRAFGLNPEEHFHIPQDVYDFFSDLPSRG
FT                   KTHEAEWHAAVAAYREAEPVLASEFDLRVAGKMPADWTKYKLGQNVKNFLVGTADLTPS
FT                   VNVAYKNKVDFQSPDLKTACGMSGNYAGRYIHYGIREHAMCAISNGLAAFNKGTFIPIT
FT                   STYLVFHLYAAAAVRMAALQGLHQIHIATHDSIGVGENGPTHQPIAVPALYRAMPNILF
FT                   IRPCDAEETVGAYIAAIQHDTTPSVLALSRQNLTQYPAHSSREGVQKGAYVFVEEENFD
FT                   VTLLSVGSEMAYTMAAREILAAEHGIKARVVSFPCARLFELQSREYKHSVLKPRAGKPA
FT                   VAIEAYPSVGWERYADAAIAQNQFGKSLPCKEVYEHFGFSGKIIADKVKGLVDEVRRDG
FT                   VEVLRGDFRDLNGGPSVGVEHPNVP"
     atggctcctg gattagaact gctccctaag accacggcct tgccgacaaa ggctgccaat        60
     gccatcaaca atgccgtcta tggcagagac tctgatgtga agtttgagag tgccgagaag       120
     caccagcggg tgttaaatgt cttcagagct ttcattgccg acctggttca gcaatatggt       180
     gacggacacc ctggagcgcc catgggcatg gcggccatcg ggattgcgct gtggaaatac       240
     gtcatgaaat actcgcccac gaattgcaac tacttcaacc gcgatcgctt tgttctttcg       300
     aatggtcacg cctgtctctg gcagtacctc ttcatgcacc ttgtcggcgt caagagcatg       360
     acccttgagc agttgaaatc ctaccactcc acagactcca gttccctatg ccccggccat       420
     ccagagatcg agaacgaagg tgttgaggta acgaccggcc cactgggtca gggtgtcgcg       480
     aacgcagttg gactcgccat ggcgaccaag aacctcgccg caacgtacaa caagcctggc       540
     tatgaagtcg tgaacaacat gacctggtgt atggttggcg acgcttgttt gcaggagggc       600
     gtcggtcttg aagctctgtc tctggctggg cactggcggc tcaacaacct ttgtgtgatc       660
     tttgacaaca ataatgtaac ctgcgatgga acggcagatg ttgccaatac ggaagacatc       720
     aacaccaaga tgcgcgcgac aggcttcaag gtgattgacg tgtatgacgg ggattcggac       780
     gttgttgcca tcaccaatgc gctcctcgct gctcgctcct ccaccaagcc aactttcatc       840
     aacattcgca ccaccatcgg cgtaggctcc aagcaagccg gcacggccga tgcgcacggc       900
     gccgccctgg gcgtcgacga agtcgccaaa atcaagcgcg cctttggcct gaaccctgag       960
     gaacacttcc acatccccca agacgtttac gacttcttca gcgatctacc atcgcgcggg      1020
     aagacccatg aggcagaatg gcacgcggct gttgccgcat accgcgaagc tgagcccgtg      1080
     ctcgcctctg aatttgacct ccgtgtcgca ggaaaaatgc cagcagactg gacaaagtac      1140
     aagctcggcc aaaacgtcaa gaacttcctc gtcggcacag cggatcttac cccctccgtc      1200
     aacgtggcct acaagaacaa agtcgacttc cagtcccccg acctcaagac cgcgtgcggt      1260
     atgagtggaa attatgcagg ccggtatatc cactacggga tccgcgagca cgccatgtgc      1320
     gcgatctcca acggtctggc ggcgttcaac aagggcacct tcatcccgat cacaagcacc      1380
     tacctcgttt tccacctgta cgctgccgcc gctgtacgca tggccgctct acaggggctg      1440
     caccagatcc acatcgccac tcacgacagc attggcgttg gagagaatgg accaacgcat      1500
     cagcccatcg ccgtaccggc actctaccgt gcaatgccaa acatcctttt cattcggccc      1560
     tgtgatgcag aggagacggt tggggcgtac atcgcagcaa tccagcacga cacaactccc      1620
     tccgttctgg cactgtcgcg ccagaacctt acgcagtacc ctgctcactc ctctcgagaa      1680
     ggcgtgcaga agggagccta cgtcttcgtc gaggaagaga actttgacgt cactctcctc      1740
     agcgtgggct ctgaaatggc ttataccatg gcagcgcgcg agatccttgc ggccgagcac      1800
     ggtatcaaag cgcgtgtcgt ttcattccct tgcgcacggc tcttcgagct tcagtcccgc      1860
     gagtacaagc actccgtctt gaaaccacgc gcgggcaaac ccgctgtcgc gatcgaggcg      1920
     tacccttctg ttggctggga gcggtatgct gatgcggcaa ttgcgcagaa ccagtttggg      1980
     aagagtctgc cgtgtaagga ggtgtatgag cactttggat ttagtggaaa aatcattgca      2040
     gataaggtga aaggattagt ggatgaggtg agacgcgatg gtgttgaggt gttaagaggt      2100
     gactttcggg atctgaatgg gggtcctagt gtcggtgtgg agcatccaaa tgtgccttag      2160
//

If you have problems or comments...

PBIL Back to PBIL home page