(data stored in ACNUC16935 zone)

EMBL: BN001307.PE137

BN001307.PE137       Location/Qualifiers
FT   CDS_pept        387229..388527
FT                   /locus_tag="ANIA_08934"
FT                   /old_locus_tag="AN8934.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007928"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007928"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007928"
FT                   /db_xref="GOA:Q5ARZ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ6"
FT                   /protein_id="CBF84623.1"
FT                   /translation="MDSAEKDLEGGSSSFCIDQSTTTTSPVSEKSVPPPPDHGLRAWLQ
FT                   VLCMHLVFLNTWGVSNGFSIFNQLYTKTLPESSSTISWIGSIQISLLFFFGVFAGRATD
FT                   AGYFRLMYMAGAFFQVFGFFMLSLCKDYWQIFLAQGICMGISNGLTFGPGLAVTSSYFS
FT                   RNRGLAVGIAAAGATTGGMIYPVLIHQLLDIHSLSFGWTVRIAAFVMLITQISGLLFFH
FT                   PRLPPRPSGPFLDSAAFKEKPFVFFALSMFLNLWGLYFAFFYMGTFARDRLAVRDTQNF
FT                   ILIQNGVGVLGRILPTRLADRVTGKFNILIPLNFTAAVVVYAWIAVHTVAGLYVFTVIY
FT                   GLAGGAAQSLFPATATTMITDVRKTGTRIGMILSFVGIATLTGPAIDGALIQAMQGEYT
FT                   GAQVFSGTCIVLRAGSALAARVAKTGWKLRVVV"
     atggacagcg ctgaaaagga cctcgaagga ggatcttcct cattctgcat agatcagagc        60
     accacaacaa ccagcccagt ctccgagaag tctgtgcctc cacccccaga tcatggcctc       120
     agggcctggc tccaagtctt gtgtatgcac ctcgtcttcc tcaacacctg gggcgtaagc       180
     aacggctttt ccattttcaa ccaactgtac accaaaaccc ttccagaatc cagttccacc       240
     atctcatgga tcggaagcat ccagatctcg ctcctcttct tttttggtgt cttcgccggc       300
     cgcgctacag acgcagggta cttcaggctc atgtacatgg ccggtgcgtt cttccaagtt       360
     ttcgggttct tcatgctgtc attgtgcaag gactactggc agatcttcct cgcccagggc       420
     atctgcatgg gaatcagcaa cggtctcacc ttcgggcccg gactggctgt cacgtcgtca       480
     tacttctcca gaaaccgcgg gcttgcagta gggatcgccg cagccggcgc aacaacaggc       540
     gggatgatat accctgtcct aatacaccag ttgcttgata ttcacagcct cagctttggc       600
     tggacagtac gaatagccgc ctttgtgatg ttgataaccc agatttccgg cttactattc       660
     ttccatcctc gcctcccccc tcggccctcc ggcccgttcc tcgacagcgc tgctttcaaa       720
     gagaagccgt ttgtcttctt cgcgctcagc atgttcctca atctctgggg tctctacttt       780
     gcctttttct acatggggac atttgcgaga gaccggctcg ccgtacgcga tacacagaac       840
     ttcatactca tccagaacgg cgtaggcgtg ctcggccgga tcctcccaac tcgcctcgcc       900
     gacagagtca caggaaaatt caacattctt atcccgctga acttcactgc tgccgttgtt       960
     gtctatgcgt ggatagccgt gcataccgtt gccgggctgt acgtcttcac agtgatctac      1020
     ggcctagccg gcggcgcagc acagtctctt ttcccggcga cagcgacgac aatgataact      1080
     gatgtacgga aaacggggac aagaattggc atgattctta gctttgtggg catcgcgacc      1140
     ctgaccgggc cggcgattga cggagcgctg attcaggcga tgcaaggaga gtatacgggg      1200
     gcacaagtgt tttcggggac ttgtattgtg ctgagagctg ggtcagcgct ggcagcaaga      1260
     gtggcgaaga cggggtggaa gttaagggtt gtggtatag                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page