(data stored in ACNUC16935 zone)

EMBL: BN001307.PE138

BN001307.PE138       Location/Qualifiers
FT   CDS_pept        join(389081..389919,390104..390153,390240..390364,
FT                   390520..390627)
FT                   /locus_tag="ANIA_08933"
FT                   /old_locus_tag="AN8933.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007929"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007929"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007929"
FT                   /db_xref="GOA:Q5ARZ7"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ7"
FT                   /protein_id="CBF84624.1"
FT                   /translation="MPSNLPLDIARTLAEHISVEPVGPETFQARFNPERQGNTASYSYG
FT                   GCALGVGVQAACQTAPDGYNLYSVTGSFLAPVLTDSKITCSVRRLRDTRTFATRQVEIS
FT                   QVQNATTRLCVIMLADFHKKEKDSLLEYSSPPDHIYSKPESCLTPQETGQKKVEQGTIS
FT                   IESLSLYNTLFGLIARFFEARQAPEGISAHNLHGMVKEQPQPPHQARLPLTAKTSADWF
FT                   RCRTPLSAKSDHYAGLAWMLDAYLTFTPLAHSGMFLDDAAACATLDFAIRFFCDEFDLI
FT                   TVRVYLLPDRALNRTEYIGDLCLMVYRSNRVSNLRATFGGYMRGDRHTPKASPVEQKND
FT                   PGAEVQGIPETYENALAYYAAAIEIRYSSHAIL"
     atgccctcga atctacccct tgatatcgcg cgcaccctgg ccgaacacat ctcagtagaa        60
     cctgtcggcc ctgagacatt ccaagcacgc ttcaacccag agcgccaagg caacaccgcc       120
     tcctactctt acggtggctg cgccctcggt gttggagtac aggcagcatg ccagaccgca       180
     ccggatgggt acaatctcta cagtgtgaca gggagtttcc ttgcgccggt gttgacagac       240
     agcaagatca cctgctctgt gcgtcggctc cgggatacac gtacgttcgc gacgagacaa       300
     gttgaaatct cgcaggtcca gaatgccacc acgagactat gtgtcattat gcttgcagac       360
     ttccacaaga aagaaaaaga ttctcttctt gaatactctt cccctccgga tcatatctac       420
     tcgaagccgg aatcatgtct cacaccccaa gaaactgggc agaagaaggt tgagcagggc       480
     accatatcaa ttgaatcgtt atcgctctac aacacgcttt tcggacttat tgctcgcttc       540
     ttcgaggccc gacaagcccc ggagggaatc tctgcacata atctccacgg catggtgaaa       600
     gaacagcccc aaccgcctca tcaagcccgt cttcccctaa cggcaaaaac gtccgcagac       660
     tggttccgct gtcgcacccc cttgtccgcc aagtcagacc actacgccgg gctggcgtgg       720
     atgcttgacg cgtatctgac gttcacgccg ctagcacata gcgggatgtt ccttgatgat       780
     gccgccgctt gtgcgacgct ggattttgcg attaggttct tctgcgacga gtttgatttg       840
     ataactgtcc gtgtatatct attgccagac agggctctta accgaacaga atacattggg       900
     gacctgtgcc ttatggtcta ccggtcaaat cgggtgtcaa acctcagggc tacgttcgga       960
     ggatatatga ggggagatag acatacgcct aaagcttccc ccgttgaaca gaaaaacgat      1020
     ccaggagccg aagtgcaagg tattccagag acatacgaaa atgccttggc gtattatgca      1080
     gcggcgatcg aaatccgcta ttcttctcat gctattttat ag                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page