(data stored in ACNUC16935 zone)

EMBL: BN001307.PE139

BN001307.PE139       Location/Qualifiers
FT   CDS_pept        complement(join(391467..392218,392274..392361))
FT                   /locus_tag="ANIA_08932"
FT                   /old_locus_tag="AN8932.4"
FT                   /product="TIM-barrel enzyme family protein (AFU_orthologue;
FT                   AFUA_1G10110)"
FT                   /note="transcript_id=CADANIAT00007930"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007930"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007930"
FT                   /db_xref="GOA:C8VLH6"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLH6"
FT                   /protein_id="CBF84626.1"
FT                   /translation="MAPPTSRPEILSRLRAQIQAGKPIVGAGAGIGLSAKSVEAGGGDL
FT                   IIIYNSGRFRMAGHGSLAGLMPYSNANEVVVEMASEVLPVVKHTPVIAGVCGTDPLRDI
FT                   PRFLSQLKGMGFAGVQNFPTVGLIDGQFRANLEETGMGYDKEVEMVRAASELGLLTTPY
FT                   VFNVGEAEAMAKAGADILVAHMGLTTSGTIGAKTGKTLEQCVDEIQAIRDVAVKINPDV
FT                   ILLCHGGPIARPEDARFILGRVAGLHGFYGASSMERLPVEVAIKDTTAEFKKIALRH"
     atggcaccac caacctcccg ccccgagatt ctgtcgcgcc tccgtgccca gatccaagcg        60
     ggcaagccta tcgtcggcgc tggagccgga attggcctct ccgctaaatc tgtcgaggcg       120
     ggcggcggcg atctgatcat catctacaac agcgggcggt tccggatggc tggtcacggg       180
     agtctcgcgg ggctaatgcc atacagcaac gctaacgaag tggtggtcga aatggcgtcc       240
     gaagtgctgc ccgttgtgaa acacacgccc gtcatcgcgg gcgtgtgcgg gacagaccca       300
     cttagggaca tccctcgttt tctctcccag ctgaagggga tggggtttgc cggggtgcag       360
     aatttcccaa cagtaggcct gatcgatggg cagtttcggg ccaacctgga ggagacgggg       420
     atggggtatg acaaggaggt ggagatggtg agggccgcaa gcgaactggg cctcttgacg       480
     accccgtatg tgtttaatgt gggcgaggcg gaagcaatgg caaaggccgg ggcggatatc       540
     ctggttgccc atatgggact tacaacgtcg ggcacgattg gcgctaagac gggcaaaacg       600
     ctggagcagt gtgtggatga gatccaggcg attcgagacg tggcggtgaa aataaaccca       660
     gatgtgatcc tgctgtgcca tgggggaccg attgcgaggc cggaggatgc gaggtttatt       720
     cttggacgag tggctggctt gcatgggttt tatggcgcca gttcgatgga aaggttgcct       780
     gttgaggtgg ccattaagga tacaacggcg gagttcaaga agattgcgtt gaggcactaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page