(data stored in ACNUC16935 zone)

EMBL: BN001307.PE140

BN001307.PE140       Location/Qualifiers
FT   CDS_pept        392626..393954
FT                   /locus_tag="ANIA_08931"
FT                   /old_locus_tag="AN8931.4"
FT                   /product="UPF0261 domain protein (AFU_orthologue;
FT                   AFUA_1G10120)"
FT                   /note="transcript_id=CADANIAT00007931"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007931"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007931"
FT                   /db_xref="GOA:Q5ARZ9"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ9"
FT                   /protein_id="CBF84628.1"
FT                   /translation="MHLILLGTLDTKRSEVLYLHSQLHQTASRLNTPLSITLIDCGVRS
FT                   EIDSDPAITVSHTDLITKYPYASDLDSPSPTKDLFVLPRGEAISIITACATKCVSELLQ
FT                   TQDVHGIIGVGGSGGTSLISAVMRSAAKIGLPKLIVSTVASGNTGPIVGETDLTLMYSV
FT                   VDIAGSNRLLKDVLENAAGAMVGMASAYKARLEASISATPAQSEKSRLRVGVTMFGVTT
FT                   PCVDTIRSHLETNYAVEVYVFHATGHGGKAMERLVEEGHLDAMLDLTTTEICDLIAGGE
FT                   MACDRRRLETSLKKGIPTIISVGATDMVNFGPIETVPPKYQGRKLFVHNPSVTLMRTSR
FT                   EECEAVGRFIVEKVNGCVREGKAGLVEVVIPKGGVSKISTTGGVFEDKQADEALANVLM
FT                   VGLEGKVRVVQDPRDVNDRGFAVDIAERLMTLVAAAGEKREKV"
     atgcacctca tcctcctggg aacgctcgac acaaaacgct ccgaagtgct ctacctccac        60
     tcccagctcc accaaacagc aagccgcctc aacacgcctc tctcgatcac tctcatcgac       120
     tgcggcgtcc gcagcgagat tgactctgac ccagccatca cagtctcgca tacagacctg       180
     ataacaaaat acccgtacgc ctccgatctc gactctccaa gcccaaccaa agacctcttt       240
     gtcctccccc gcggcgaggc aatctctatc atcacggcct gtgccacgaa atgtgtgtcc       300
     gaactcctac agacacagga cgtccatgga attattggcg taggcggcag cggcggcacg       360
     agtctcatct cggctgtcat gagaagcgcc gcaaagattg gtctgcccaa acttatcgtc       420
     tccaccgtgg cctcaggaaa cacgggccct attgtcggcg agacagacct cacgctcatg       480
     tacagtgtcg tcgatattgc tgggtcgaat cgactgttga aggatgtcct cgaaaacgcg       540
     gcgggggcga tggtcgggat ggcgagcgca tacaaggcgc gtcttgaggc gagcatatcc       600
     gctaccccag cccagtcaga aaagagcaga ctccgtgtgg gagtcactat gttcggcgtg       660
     acgacgccct gtgtcgacac gatccggtcg cacctcgaaa ccaactacgc tgtcgaggtc       720
     tatgtcttcc acgcaacagg gcatggaggg aaagccatgg agcggctggt ggaggaagga       780
     cacctcgacg cgatgctcga cctgacgaca acggagatct gcgatctcat cgcgggaggg       840
     gaaatggcgt gtgatcgccg ccgactcgaa acgagtctga agaagggtat cccaactatc       900
     atctctgtcg gcgcgacaga tatggtcaat ttcggcccga tcgagacggt cccgccgaag       960
     tatcaaggaa ggaaattgtt tgtgcataac cccagtgtaa cactcatgag gacgtccagg      1020
     gaggaatgcg aggccgtagg gagattcatc gttgagaagg tgaatgggtg tgtacgggag      1080
     ggtaaagctg ggcttgtgga ggtggtgatt cctaagggtg gagtgagcaa aatttctacg      1140
     actggaggcg tctttgagga taaacaggcg gatgaggcgc ttgcgaacgt tctcatggtc      1200
     ggactggaag gcaaggtcag agttgtgcaa gatccgaggg atgtgaatga tagagggttc      1260
     gccgttgata ttgcagaaag gctgatgaca ttggtagcag ctgcaggcga gaagagggaa      1320
     aaggtctaa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page