(data stored in ACNUC16935 zone)

EMBL: BN001307.PE142

BN001307.PE142       Location/Qualifiers
FT   CDS_pept        join(397530..398256,398328..398938)
FT                   /locus_tag="ANIA_11151"
FT                   /old_locus_tag="AN11151.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007933"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007933"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007933"
FT                   /db_xref="GOA:C8VLH9"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLH9"
FT                   /protein_id="CBF84632.1"
FT                   /translation="MIFLWLLLLAYRVTAKLFEAPNPWEEASQVIVSNVTLDSNPVSNS
FT                   SVPSIDHNTRQNTEYVRLQSRLDRTSGTWGASHPRHRLLMALYGFSRYKERSSAEVKRW
FT                   RDLYKHVPKSQKQLVERVIGYTRKLNTVEHLYDHNDVLAGDIVRFGMEFYGIEQTELDV
FT                   FIQDMEKEKKGADRTSVVQAMKHFVRDWSDEGLFEREGAFRCILDSISGIERGGEERPV
FT                   SVLVPGAGAGRLGYEIDALGGFEVTINEWSAYMNLIHRYVVQINAPESLVYHPYIDWWS
FT                   HHATTSDMQRGVSFPDSIPRPSSKASIVMIEGDFTTIFEDADSSTYDIIVTLFFIDTAR
FT                   NLLNYLETIYRLLKPGGRWINLGPLLYGTGPWLQLSLDEIVKLSEALGFEFEVDVSDQA
FT                   GIVCGTLTQGEGLGGKVRSMYVPYGQNKRGLSRNAYDAQFWRARKR"
     atgatttttc tttggctgct gctcctggcc tatagagtaa cggcgaaact attcgaagcg        60
     ccgaatccgt gggaggaagc cagccaagtc atcgtctcaa acgtcacact cgattccaac       120
     cccgtctcca actcatcagt tccctccatt gaccataaca cgcgccagaa tacagaatac       180
     gtgcgcctgc aaagccgcct cgaccggaca agcggaacat ggggcgcatc tcacccgcga       240
     caccggctcc tcatggccct ctacggcttc agcaggtaca aagaacgcag ttcggctgaa       300
     gtaaagaggt ggcgcgatct gtacaaacac gtcccgaaaa gccagaagca gcttgttgaa       360
     cgagtgatcg ggtatacgcg caaactgaat acggtcgagc atctttatga ccataatgac       420
     gtgctcgcgg gggatattgt acgatttggg atggagtttt atggcattga gcagaccgaa       480
     ctggatgtgt tcattcagga tatggagaaa gagaagaagg gtgctgatcg gacgagcgtc       540
     gtccaagcca tgaaacactt tgtgcgagac tggtcggacg agggactctt cgagagggag       600
     ggtgcgttca gatgtattct ggactctatc tctggtattg agcgcggggg tgaggaaaga       660
     ccggtcagcg tcttggttcc tggtgcaggg gcagggcgat taggctacga gatcgatgct       720
     ctaggaggtt tcgaagtaac gatcaacgag tggtccgcat acatgaacct gatccatcgc       780
     tatgtagtcc aaatcaacgc tccggagagc ctggtctacc acccctatat agactggtgg       840
     tctcaccacg ccaccacgtc cgacatgcag cgcggcgtat cgttccccga ttccattccg       900
     cggccgtcct ccaaggcaag tatagtaatg attgaaggcg acttcactac catctttgaa       960
     gatgcggact caagcaccta cgacataatc gtgaccctct tcttcatcga taccgcacgc      1020
     aatctgctaa actatctcga gacgatctac cgtcttctga aacccggcgg aaggtggata      1080
     aatctgggtc cattgctcta cgggacaggc ccatggctgc agctttcact cgatgagatt      1140
     gtaaagctga gtgaggcgtt agggtttgag tttgaggttg atgtttcaga tcaagccggg      1200
     attgtctgcg ggacgctgac gcagggagag ggattgggcg gcaaggttag gagtatgtat      1260
     gtcccgtatg gacagaataa gagggggctc agtcggaatg cgtacgatgc gcagttctgg      1320
     agagcgcgga agaggtaa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page