(data stored in ACNUC16935 zone)

EMBL: BN001307.PE143

BN001307.PE143       Location/Qualifiers
FT   CDS_pept        join(399381..399557,399620..399728,399789..399938,
FT                   399994..400670,400732..400883,400965..401163)
FT                   /locus_tag="ANIA_11153"
FT                   /old_locus_tag="AN11153.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007934"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007934"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007934"
FT                   /db_xref="GOA:C8VLI0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI0"
FT                   /protein_id="CBF84634.1"
FT                   /translation="MDSKEQDNNLNHDNPTLNDIFEEHEPTSDTSLLRRIDVRILPIMF
FT                   LAYFLQFLDKVCLNYANVMGIQDELSMSGNDFSWLATAFFIAYAVAEVPQGYLLQKYPV
FT                   TKVLAANIFIWGVMLCCSAAVQNYAGLLALRVLLGTAEAVIAPALTIYTSMWYTPAEAS
FT                   PRFGLWYCGLGTGQILGGLISFGAQHASSSQSFSGWRIMFLVIGFANIAVSLLVLVVLP
FT                   VSPETASFLSPDAKTRIFHRLKSAVTGGLGNKTFHAPSVLTTLGDPQTWLLCLLTILVT
FT                   IPSGLIVTFSSILIKGFGYTSKESALLNMPSGVVSILSILLSTYAVAKGYSRWLAIDLL
FT                   LVPTLLGSCLMSFLPKSNQAGLLVGIYMVNTTVAPLILIFAWTGANFKGYTGKVTGCAF
FT                   ISAAFSIANIIGPQTFQARDAPEYLPAKVTIVVANAAAIAVSTALRLLYGSRNREAERL
FT                   GALVSAKSWMEKRVVRQVEEEETGFRYIY"
     atggacagca aggaacaaga taacaacctc aatcatgaca atccaaccct caatgacatt        60
     ttcgaagagc acgagcccac ttcagacaca tctctactcc gccgtatcga cgttcgcatc       120
     ctcccgataa tgttcctagc ctacttcctg cagtttcttg acaaagtgtg tctaaattac       180
     gcaaatgtaa tgggcataca agatgagctc tccatgtctg gaaacgactt ttcctggcta       240
     gcaactgcgt tctttatcgc ctatgcagtt gctgaggtcc cacaaggata cctactgcag       300
     aaataccccg tcacaaaggt cctagccgcc aatatcttta tctggggcgt gatgctctgc       360
     tgctctgctg cagtgcagaa ctatgccggg cttctagccc tccgtgtcct tttgggaacg       420
     gcagaagctg taattgcacc cgcattgacc atctatacaa gcatgtggta cacacccgct       480
     gaagcaagcc cgcgctttgg gctttggtat tgcggtctcg gaacggggca gatcctcggc       540
     ggtctcattt cattcggtgc acaacatgcc tcgtcctcgc aatccttttc cggttggagg       600
     attatgtttc tcgttatcgg gtttgcaaat attgccgtct cattactcgt tctggtcgtt       660
     ctgccggtct caccggaaac agcgtctttc ctgtccccgg acgcgaaaac acgtatattc       720
     caccggttaa agagcgctgt gacaggcggg ctcggaaaca agacattcca cgcgccctcg       780
     gtgttaacta ctttaggtga tccccaaacc tggctcttgt gcctcctcac catcctcgtc       840
     actatccctt ctggtctgat cgttaccttt tcctcaatcc taataaaggg gttcggttat       900
     acttctaagg aatcggctct cctgaacatg ccgtctggcg tggtaagtat cctctccatc       960
     ctgttgtcca catacgcagt cgcaaagggg tactcgaggt ggcttgcgat cgaccttttg      1020
     cttgtcccga cgctattggg ctcatgtctc atgagttttc tgccgaagag taatcaggcc      1080
     ggattgttgg tggggattta tatggtaaat acgactgtcg cccccttgat tctgatcttc      1140
     gcctggacgg gagcgaattt taaggggtat accggcaagg tcacaggctg cgcgtttata      1200
     tctgcagcat tcagcattgc gaatatcatc ggcccgcaga cctttcaggc gagggatgct      1260
     cctgaatatc ttcccgctaa ggtcaccatt gtggtcgcga atgctgcagc gatcgcggtc      1320
     tcaactgcgc tgaggttgct ctacgggagc aggaaccgag aggctgaaag gctaggggct      1380
     ctggtttcgg cgaagagctg gatggaaaaa cgggtcgtca ggcaggtgga ggaagaggag      1440
     actggattcc ggtatattta ctga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page