(data stored in ACNUC16935 zone)

EMBL: BN001307.PE144

BN001307.PE144       Location/Qualifiers
FT   CDS_pept        join(401558..401841,401924..401978)
FT                   /locus_tag="ANIA_11154"
FT                   /old_locus_tag="AN11154.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007935"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007935"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007935"
FT                   /db_xref="GOA:C8VLI1"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI1"
FT                   /protein_id="CBF84636.1"
FT                   /translation="MAALQKFKLVFHVPPSSLEPVQKAIFAAGAGRYPGPGNYTECCWV
FT                   TSGTGQFRPGDAANPAIGKVGELEKIEELRVETLCVGVDVARKAVEALKKAHPYEEPSY
FT                   GVIRLEDF"
     atggctgccc ttcagaaatt taaactagtc ttccacgtcc ccccatcgtc cctcgagccc        60
     gtccagaaag cgatcttcgc tgcaggtgca ggccggtacc caggaccggg caactacacc       120
     gaatgctgtt gggtgacgtc gggaacaggt caattcaggc cgggtgacgc agcaaatccc       180
     gccattggga aggtgggcga gcttgagaag atcgaggagc tcagggtcga gacgctctgt       240
     gtgggagttg atgtggcgag gaaagcggtt gaggcgttga agaaggcgca tccatatgag       300
     gagccgtcgt acggggtcat tcggctggag gacttttag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page