(data stored in ACNUC16935 zone)

EMBL: BN001307.PE146

BN001307.PE146       Location/Qualifiers
FT   CDS_pept        410978..412045
FT                   /locus_tag="ANIA_08927"
FT                   /old_locus_tag="AN8927.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007937"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007937"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007937"
FT                   /db_xref="GOA:Q5AS03"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS03"
FT                   /protein_id="CBF84640.1"
FT                   /translation="MTKSNFITAAVLAFAATVSAQCGSGTPDAIVDGSEGAYTATVEGS
FT                   EVYSGSDFYTAITSALDGISSGQRLSILASGSIGTNVVSIPSGRIFEGCGTIDVQANSG
FT                   RGNIRSLNTENVQIPYLTLTGSPYFGLHFYGVSGLSLGQITMNLSGGLGIRFERDEAAN
FT                   SDVSMDVINITGAGSHAVETWNIDGLTINQVIARDVGECGLLLQTTTNARIGTVDGDNV
FT                   AAGTGYATFRMANANGRLSDGSYDTNVYVENVIARGGGRGIFCVSESGGVEIGNVDISD
FT                   TENNAILIENCYGVSILGGSVNGGGDVRIAARDEFENTRDVSISLEVNGANVVENPCGE
FT                   NITWDITGDATLNVC"
     atgaccaagt ccaacttcat tactgcggca gtcctagctt tcgctgcaac tgtctccgcc        60
     cagtgcggct cgggcacccc cgacgccatc gttgacggct ccgagggtgc ctacacggcc       120
     actgttgagg gcagcgaggt ctactctggg tccgatttct ataccgcgat cactagcgct       180
     ctcgacggga taagctcggg ccagcgtctg tccattcttg catccggctc tatcggcacc       240
     aatgtcgtct ccattcccag tggacgcatc ttcgaaggat gcgggacgat cgacgtgcag       300
     gcgaacagcg gccgaggaaa tatccggtca ttgaacacgg agaacgtgca gatcccatac       360
     ttgacgctga ctgggagccc gtattttggg cttcacttct acggcgtctc tggtctgtct       420
     ctcggtcaga tcacgatgaa tttgagcgga gggctgggga tccggttcga gcgcgatgag       480
     gcggcgaatt ctgatgtctc gatggatgtg atcaacatca ctggcgcggg aagccacgct       540
     gtcgaaactt ggaacattga tggtctcacc atcaaccagg tcattgcccg ggacgtcggg       600
     gagtgcgggc ttctcctgca gaccaccacg aacgcgcgta tcgggacggt tgacggagac       660
     aacgtcgctg caggcaccgg ctacgcgacg ttcaggatgg ccaatgcaaa tggtcgcctg       720
     agcgatggga gctacgacac caatgtctat gttgagaacg tgattgcgcg cggtggagga       780
     agaggcatct tctgtgtctc tgagagtgga ggtgttgaga ttggcaatgt ggacatcagt       840
     gacacagaga acaacgcgat cctcattgag aactgctatg gcgttagtat tctgggcggc       900
     agcgtcaatg gaggaggcga tgtgaggatc gcggccaggg atgagtttga gaatacgcgc       960
     gatgtgagca tcagcctcga ggtcaatggg gcgaacgtag ttgagaatcc gtgcggcgag      1020
     aatatcacct gggatattac tggtgacgcg accttgaatg tctgttag                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page