(data stored in ACNUC16935 zone)

EMBL: BN001307.PE148

BN001307.PE148       Location/Qualifiers
FT   CDS_pept        join(414345..414429,414521..414568,414967..415089,
FT                   415165..415210,415245..415248)
FT                   /locus_tag="ANIA_08926"
FT                   /old_locus_tag="AN8926.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007939"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007939"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007939"
FT                   /db_xref="GOA:Q5AS04"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS04"
FT                   /protein_id="CBF84644.1"
FT                   /translation="MPFTAHPNTTSSSNDWSEKDVFAMKVMRKSYGIVVALVVSRILGG
FT                   AGHLGGFQRARKVAGGEDEKGQRGIWRLLGLFYSDKRLGDGSAGEEPDKTIGVLEG"
     atgcccttca cagcgcaccc aaatacaact tcgtcaagta atgactggag tgaaaaggat        60
     gtctttgcca tgaaagtgat gcgaaagtca tatggtattg tcgtcgctct cgtcgtctcg       120
     cgcatccttg gaggagcagg ccatctcggt ggattccaga gggctcgaaa agttgcagga       180
     ggtgaagatg aaaaaggaca acgagggata tggcgcctcc ttgggctttt ctacagtgat       240
     aaacggctag gcgatggttc cgcaggcgaa gaacccgata agacaatcgg cgtgctggaa       300
     ggttag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page