(data stored in ACNUC16935 zone)

EMBL: BN001307.PE149

BN001307.PE149       Location/Qualifiers
FT   CDS_pept        join(417218..417441,417540..417732,417829..417924)
FT                   /locus_tag="ANIA_08925"
FT                   /old_locus_tag="AN8925.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007940"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007940"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007940"
FT                   /db_xref="GOA:Q5AS05"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS05"
FT                   /protein_id="CBF84645.1"
FT                   /translation="MEDNALESAVPSAEGCRTAYEKGSASGQAFIGVLSGFPYTCFQFQ
FT                   QALLHQPYFPDDLDLELTYDNISVSGSSICASADLGQSLHNWFKNERTHLTVLVFPWSY
FT                   IFSARWAGLMPKATLAYTDSKAYDSDKPEEDDSAMINFDLPGQYLFRQTSTFPIAKTTI
FT                   RPQIQPY"
     atggaggata atgctttaga gagcgctgtt cccagcgctg aaggatgccg gacagcgtac        60
     gaaaagggtt ccgcatctgg tcaagccttt ataggcgtgc tatctggctt tccctacacc       120
     tgcttccagt tccagcaagc acttctacac cagccttatt tcccggatga cctggatctg       180
     gagcttactt atgataatat ctctgtctct gggtcatcaa tctgtgcctc tgcagacctg       240
     ggccagagtc ttcataattg gttcaaaaac gagagaaccc acctcactgt gctggtattt       300
     ccatggagct atattttctc tgcgcgttgg gctggactta tgcccaaagc cacactcgca       360
     tatacggata gcaaggcata cgacagcgac aaacccgaag aagacgattc tgctatgata       420
     aatttcgatc tccctggtca atatctcttc cggcagacct cgacctttcc tatcgcaaaa       480
     accactattc gccctcagat acagccgtat tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page