(data stored in ACNUC16935 zone)

EMBL: BN001307.PE15

BN001307.PE15        Location/Qualifiers
FT   CDS_pept        join(46803..47035,47297..47377,47430..47465,47601..47602,
FT                   47788..47922,48166..48215,48273..48417,48482..48498)
FT                   /locus_tag="ANIA_09046"
FT                   /old_locus_tag="AN9046.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007807"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007807"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007807"
FT                   /db_xref="GOA:Q5ARN4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN4"
FT                   /protein_id="CBF84396.1"
FT                   /translation="MPRVRVSSSQNCHEKEGRLLLAVQAIKKKEITLICEAAHHFNVPE
FT                   SILCTRLRGTTNRAESRANGHKLTEIEEEVLKQILPDNIYNFDKTGFAIGLCAHQKVIT
FT                   KLLQLSQSVLLDRILKRSYASLVDQKMWLGISYINKLDFLAAYPQARISIFKLDTIRNS
FT                   CQIAMQKVILLEQENRIAHDNGLSVQEATELEEAYNVSFQAIPGPCGPPAEGAQTPKAW
FT                   ALPIYSVVVD"
     atgccccgag ttcgcgttag ttcaagccaa aattgccatg agaaggaagg tcggctccta        60
     ctggctgtac aggctattaa aaaaaaggag attacattaa tatgtgaggc agcacatcac       120
     ttcaatgtgc ctgaatctat actatgtacg cgactacgcg ggactacaaa tcgcgccgaa       180
     tctcgcgcaa atggccataa attaactgag attgaagagg aagtgcttaa gcagatccta       240
     ccggataata tctacaactt tgataagact ggctttgcaa taggcctttg tgcacatcag       300
     aaagtaatta ctaagttact gcaattaagt caatcagtgc ttctggatag aattttgaag       360
     cgctcgtacg ccagcttggt tgatcagaaa atgtggcttg gtatcagcta tattaacaaa       420
     cttgatttcc ttgcagccta tccacaagct cgaatcagca tatttaagct ggatacaatc       480
     agaaacagct gtcaaattgc aatgcaaaag gtcatactat tggagcaaga gaataggata       540
     gctcatgata atggtctgtc tgtacaagag gctacagagc tcgaggaagc ttataatgtg       600
     tcttttcagg caatacctgg tccatgcggg ccaccagcag aaggtgcaca aacaccaaag       660
     gcatgggcat tacctatata tagcgttgtg gttgattaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page