(data stored in ACNUC16935 zone)

EMBL: BN001307.PE150

BN001307.PE150       Location/Qualifiers
FT   CDS_pept        complement(join(419825..420882,420950..421166))
FT                   /locus_tag="ANIA_08924"
FT                   /old_locus_tag="AN8924.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007941"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007941"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007941"
FT                   /db_xref="GOA:C8VLI7"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI7"
FT                   /protein_id="CBF84647.1"
FT                   /translation="MAPTLPLPPLQRLQNLASRTFDPGATADSFREEWSNPSNYAFTIL
FT                   LLIGGDLIHRALAQLVGGPIAPVAFSFGWVSYATSAVCSALGEYRLMPDADTGCSLING
FT                   KNGYVRGNNSWVLGRMMRDYDYWMHPAIREKTQNLIDARWKFDQAREDEKYPDSGIKVP
FT                   RPSQAGLVVSVYKPSKTLQAGVPGKDLLYWSGILCTVLQLGIASIPAGINGDWGVLMIT
FT                   GAATVLCYGTGALTQWKVEKWACRRLDNRNKKNFVLTRGNGAQHAIAIVSDGVGLDLED
FT                   LATGFSMIDYPTITVVAQLLTIVLGIAWVALLITASGIDTGSWYLIAVGGIGMLQNIFV
FT                   AGWKRTPAAYGVPLEFVEVVGEVKVMGTLMELERRYEKLGKSLLGTFFPGDLRDNEVKQ
FT                   WEEIKEEWKRKKERGEGAGDDRKGK"
     atggccccca cgctgccact cccacccctc cagcgcctcc agaatctcgc atcccgcacg        60
     tttgacccgg gtgcgacagc agacagtttt cgcgaggaat ggtcgaatcc gtcaaattat       120
     gcctttacca ttcttctgct catcggcggg gatctaatcc atcgcgctct cgcgcagctt       180
     gtcggcggac cgattgcgcc agttgcattc tcatttggat gggtctccta cgcaacctcc       240
     gctgtgtgct ctgccctcgg cgagtaccgc ctcatgcccg acgcagatac agggtgcagt       300
     cttattaacg ggaaaaacgg ctacgtccgc ggtaacaaca gctgggtcct tggccggatg       360
     atgcgcgact acgactactg gatgcatccg gcgattcgcg aaaagacaca gaacttgatc       420
     gacgcccgct ggaaattcga ccaagcacgc gaagatgaga agtaccctga ttctggcatt       480
     aaggtgccac ggccgtcgca ggcaggattg gtcgtcagtg tatataaacc aagcaagacg       540
     cttcaggcgg gcgtcccggg caaggacctg ctctactggt ctggcatact gtgtacggtg       600
     ctacagctgg ggattgctag tatccccgct ggaatcaatg gggactgggg tgtgctgatg       660
     atcactggcg cggcgacggt gttatgctat ggaaccgggg ccttgacaca gtggaaggtc       720
     gagaagtggg cttgccgacg gctggataat cgaaacaaga agaattttgt gctgacgagg       780
     gggaatggag cgcagcatgc tatcgcgatc gtgtcggatg gcgtcgggct cgatctcgag       840
     gatttggcga cggggttcag catgatagac tacccgacta ttactgttgt ggcacagctt       900
     ctgacgatcg tgctgggtat tgcctgggtt gcgttgctga tcacggctag cggaatcgat       960
     accgggagct ggtatcttat cgccgtcggg ggaattggaa tgctgcagaa tatctttgtt      1020
     gctgggtgga agaggacccc ggccgcgtat ggtgttccac tggagtttgt ggaggtcgta      1080
     ggggaggtca aggttatggg gacgctgatg gagctggaga ggagatacga aaagctgggg      1140
     aagagtctgt tgggtacttt ctttccgggc gatctgaggg ataacgaagt caaacagtgg      1200
     gaggagatca aggaggagtg gaagaggaag aaggagaggg gagagggagc tggagacgac      1260
     aggaagggga agtag                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page