(data stored in ACNUC16935 zone)

EMBL: BN001307.PE151

BN001307.PE151       Location/Qualifiers
FT   CDS_pept        complement(join(421784..423080,423162..424246))
FT                   /locus_tag="ANIA_08923"
FT                   /old_locus_tag="AN8923.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007942"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007942"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007942"
FT                   /db_xref="GOA:Q5AS07"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS07"
FT                   /protein_id="CBF84649.1"
FT                   /translation="MEHLPLHAGKKHFIVAPYEAPESDWFDISRESFLSFPSARHWTEA
FT                   QLHGGDETTKDAHLDPDGFHRKGSPQKVEQFFQTWLFFGLAIDVLRFGGVRASVEDFLK
FT                   PATQTHAKARIVNTSRLPGMLVDWEKGIKARGRLMKDWDTLNEMFERAGSILDRFCRLP
FT                   NPEEDNSLLQQERPRLWPVRDEIATTLIAMACTLRRTAYNVCSKEISGLVDGVSPWPKT
FT                   ARSGILMRRLETKWCVADMMTTLTQLPIDGHYYLAASAGLEPDELDHHSKCVRAHCRYE
FT                   YDANMYRTRHVTDDGCREEVRYGGHLGPERGQRDWVDAMTKIIDKDAIPIALWNKGMKK
FT                   LWSVEYHLTGRRRPDFVAISHVWTDGKGNPDANSLPECQLDRIQRLVEGVTWEGRYRIP
FT                   ESDYESDGVGFWMDTLCIPANDKARKDKAITTMRRVYSEAKAVLVLDDWLQEIRSDAPP
FT                   LDLITRIFQSNWIKRLWTHQEGFLPKALWFQFKDRAVEINELREGFGAYESSLQRQGIH
FT                   LGFPRGAEMRLVGQYSVLQRMFGLTSATEKWRLYFPLAAAMSERKTSRLADETICLATI
FT                   VDIPFADLQEIPAKPDIDSGGKRMALFLEKLGKFSTGVIFNNYPRLDQRGYRWAPRSLL
FT                   NFRTAKITSAGAEPGFDIASFNPNRRPGLLAQYHGFLVNFGLGKPFAGVERGCAIQCAG
FT                   SADSGQDLDGKWFLVQLPRNNSNVEWQTWQTYAVILSEIPKQRATAPAVVASLQERQED
FT                   GIHVVIHQNIASVWMTQEPPEGVSTVRTALLRKRTKWLVG"
     atggagcatc tccctctcca tgccggcaag aaacacttta ttgtagcccc ctatgaagcc        60
     cctgaatccg actggttcga tatctcccga gaatccttcc tttcttttcc ctccgcacgg       120
     cactggactg aggctcagct gcacggcggc gacgagacaa ccaaagacgc acacctcgac       180
     cccgacgggt tccacagaaa aggtagtccc cagaaggtgg aacagttctt tcagacatgg       240
     ctcttctttg gcctcgccat cgatgttctc agatttggtg gtgtcagggc ctcggtggaa       300
     gatttcctga aacccgcgac gcaaacgcac gccaaagcac ggatcgtgaa cacgagtagg       360
     ctccccggaa tgctcgtaga ttgggagaag gggattaaag cgaggggccg gctcatgaag       420
     gactgggata cactgaacga gatgttcgag cgcgcgggaa gcatcctcga ccgattctgc       480
     aggttaccca atcctgaaga ggataactcg ctgctgcagc aggagaggcc gcgcctttgg       540
     ccggtgcggg atgagatcgc gacgacgttg attgcaatgg catgtactct tcgccgcaca       600
     gcatataacg tctgcagcaa ggagatcagc ggactcgtcg acggggtctc accatggccc       660
     aagaccgctc gctcggggat tctgatgcga cggctcgaga cgaaatggtg cgttgcagat       720
     atgatgacga ccctgacaca gctgcctatc gatgggcatt actaccttgc tgcctcggcc       780
     ggtctggagc cagacgagct ggaccaccat tccaagtgcg tgagggccca ttgccggtat       840
     gaatatgacg cgaatatgta ccggactcgc catgtgacgg acgatggatg ccgcgaggag       900
     gtcaggtatg gcggacacct cggccccgag cgcgggcaga gagactgggt cgatgccatg       960
     accaaaataa tcgacaagga cgctatccca atcgcgcttt ggaataaggg gatgaagaag      1020
     ctgtggtcgg tcgagtatca tcttacaggg cggcggcggc cggactttgt ggccatctcg      1080
     catgtctgga ccgacggcaa aggcaacccg gacgccaact ccctgccaga atgtcagctc      1140
     gaccgtatcc agcgccttgt cgaaggcgtc acctgggaag gccgctacag aatccccgag      1200
     agcgactacg aatcagacgg ggtaggtttc tggatggata cactctgcat ccccgccaat      1260
     gacaaagcgc gtaaagacaa ggcgatcact acaatgcggc gtgtctactc ggaggccaaa      1320
     gcagttctcg tcctcgacga ctggctgcag gagatccgct ccgacgcgcc acccctcgac      1380
     cttatcacgc gtatattcca gtcgaactgg atcaagaggc tttggactca ccaggaaggg      1440
     ttcttgccta aggcgctctg gttccagttc aaggatcgag ccgttgagat taacgaactc      1500
     agggagggat tcggcgcata cgaatcctca ctccagaggc agggaatcca cctcggattt      1560
     ccccgcggcg cagaaatgag actcgtcggc caatatagcg tcctgcagcg catgttcggt      1620
     ctcacttctg caaccgagaa atggcgcctc tacttcccac tggccgcggc gatgtcagag      1680
     cgcaagacct cgcggctagc ggacgagacc atatgtcttg cgacgatcgt cgacataccc      1740
     tttgcggacc tgcaggagat cccggccaag ccggacatag attcgggagg caagcggatg      1800
     gcgctgttcc tcgagaagct gggcaagttc agtaccgggg tgatattcaa caactacccg      1860
     cgcctcgacc agcgcgggta ccgctgggcg ccgaggtcgc tactgaactt tcgcaccgcg      1920
     aagatcacat ctgctggcgc tgagcccggt ttcgatattg cgtctttcaa cccgaaccgt      1980
     cgacccggcc ttctcgccca ataccacggc tttctcgtca attttgggct cgggaagccc      2040
     tttgcgggcg tggaacgcgg gtgcgcgatc cagtgcgccg gttctgcgga ctcagggcaa      2100
     gacctcgatg ggaagtggtt tctcgtccag ctccccagga acaatagtaa tgtcgagtgg      2160
     cagacctggc agacctacgc agtcatacta tccgagattc cgaagcagag agcaacagca      2220
     ccggcggtcg tggcgagtct tcaagaaaga caggaggatg ggatccatgt agtcatccat      2280
     cagaatatcg catccgtctg gatgacccaa gagccgccag agggagtcag tactgtgcgg      2340
     acggccctac tgaggaagcg gaccaagtgg ctggtaggat ga                         2382
//

If you have problems or comments...

PBIL Back to PBIL home page