(data stored in ACNUC16935 zone)

EMBL: BN001307.PE152

BN001307.PE152       Location/Qualifiers
FT   CDS_pept        join(425175..425217,425290..425495)
FT                   /locus_tag="ANIA_11634"
FT                   /old_locus_tag="AN11634.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007943"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007943"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007943"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI9"
FT                   /protein_id="CBF84651.1"
FT                   /translation="MAVQATATAVEDGHFSPWYGTVRSALVDSFNNSPLTSNVVSPSIS
FT                   IALPSVMFHGDMLRPSLCVSAVTKMLSDDDRHTHKGC"
     atggccgtcc aagcaactgc aaccgccgtt gaagacggtc acttctcgcc ctggtacggc        60
     accgtgcgat ctgccttggt cgattcattc aacaactcgc cccttaccag caacgtcgtc       120
     tcaccctcga tatcaatcgc gcttccatca gtcatgttcc atggcgacat gctgagaccc       180
     agcctttgcg tgagcgcggt aacgaaaatg ctatccgatg atgatcgtca cacccacaaa       240
     gggtgttga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page