(data stored in ACNUC16935 zone)

EMBL: BN001307.PE153

BN001307.PE153       Location/Qualifiers
FT   CDS_pept        complement(join(425618..425835,425888..425949,
FT                   426005..426237))
FT                   /locus_tag="ANIA_08922"
FT                   /old_locus_tag="AN8922.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007944"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007944"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007944"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS08"
FT                   /protein_id="CBF84653.1"
FT                   /translation="MMPRTSFRVTTLFLAIFCPLTASAAVSGWRKDVTIDAPVTRSSDE
FT                   LRTLWKRRRGDSSGSDSDSDSGSSSGGYGYDDSTSLVKHTAKDICTFTLCGIGKKQASK
FT                   AAIPQGSGTPLSWDNSSGSWISLDFLWSPVSMIPPTSPTSASNPKYFSTSPTTQTWAPS
FT                   HFTFSGA"
     atgatgccca gaaccagttt tcgggtgaca acgctctttc ttgcaatctt ttgcccgtta        60
     accgcgtcag cggctgtaag cggttggcgc aaagatgtca ccattgacgc gccggtgaca       120
     cgatcaagcg acgagttgag aaccctatgg aaacgccgac gaggagacag cagtggcagt       180
     gacagcgact ctgattcagg ctcgagctct ggaggctatg gctacgacga ctctacgtca       240
     cttgtaaagc acacagcgaa ggatatatgc acttttactc tgtgtggaat tggaaagaaa       300
     caagcctcga aggcggctat accccagggc tccggcacac cacttagctg ggacaacagc       360
     tccggctcct ggatcagtct cgacttcttg tggtccccag tctcgatgat cccgcctaca       420
     tctcctacct cggcgtcgaa ccccaagtat ttctcgacct cccctacgac ccagacctgg       480
     gccccatccc attttacatt ctctggagcg tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page