(data stored in ACNUC16935 zone)

EMBL: BN001307.PE154

BN001307.PE154       Location/Qualifiers
FT   CDS_pept        complement(join(427417..427441,427523..427549,
FT                   427623..427672,427890..429042,429103..429653))
FT                   /locus_tag="ANIA_08921"
FT                   /old_locus_tag="AN8921.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007945"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007945"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007945"
FT                   /db_xref="GOA:Q5AS09"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS09"
FT                   /protein_id="CBF84655.1"
FT                   /translation="MTRPIVVLGAGVLGRRIAAVLIAGGHTVHIRDPSTQALSDAASFI
FT                   DAHLHEFTAITPTPHPVPGTYKAFAEISSAVAGAWLVIEAVPEKLSLKIDTFAEVDRHA
FT                   PADCVIASNSSSFKSSLMVEKVGEQRKERVLNVHFTMPPQIRTVELMTNGQTRPELFES
FT                   LSKMLKGCGMIPVTARKESTGFIFNRLWAAIKREIMLILAEDVSTPEEIDLLWTNMFQL
FT                   PTSSPPCQLMDKIGLDTVAFIEDNYIQERGLDGSMTVDWLRKSYIDQGRLGLKSEKGGL
FT                   YGPSAAAAPAAATKAAQSLYILDVGLGSNNKVDQIPTAGKILYFDQSTGNMSPIVTGQS
FT                   LPDGVDVSKSTGRLFWTNMGRATSTRDGSVHSAKLDGSDMQTLLPTGSVHTPKQLVVDD
FT                   MNRKIYFCDREGMGVHRCNFDGSGHEVLIQTGSLDCAEHRSDLTRWCVGIAVDTPHRYI
FT                   YWTQKGPSKAGRGRIFRAGLEIPAGQTAENRTDIELLLDGLPEPIDLDLEVKSQKLYWT
FT                   DRGEHPIGCSLNCVDLSGSTQLEKLKSNKEILARHFNEPIGLRVAGDGTVYLIKKCVIL
FT                   QGSASLYKQDSDITHRSRNYLSSMA"
     atgacgcgcc caatcgttgt cctcggtgcc ggcgtcctag gaagacggat cgccgccgtc        60
     ctgatcgcag gcgggcacac cgtgcacatc cgggacccct cgactcaagc cctcagcgac       120
     gcggcctcat tcatcgacgc ccatcttcac gaattcactg ccatcacacc aacgccgcat       180
     cccgtccccg gcacatacaa agcgttcgcc gagatctcct ctgcagttgc aggcgcctgg       240
     cttgtcattg aggcggtgcc ggaaaagctg tcgctgaaaa ttgacacgtt tgcggaggtc       300
     gatcgccatg caccggctga ttgcgttatt gcgtcgaaca gtagcagttt caagtccagt       360
     ttgatggtag agaaggtggg cgagcaacgg aaggaacggg tgctaaatgt ccatttcacc       420
     atgccgccgc aaattcggac agtcgagcta atgacgaacg gtcaaacgag gcccgaactt       480
     tttgagagct tgagtaagat gttgaaggga tgcggaatga tccctgttac ggccagaaag       540
     gaatcgactg gcttcatctt caaccgtctg tgggcggcaa tcaagcgtga gattatgctc       600
     atcttagcag aagacgtgag cacgcccgag gaaatagacc tcttgtggac gaacatgttt       660
     cagctgccaa ccagctctcc gccgtgccag ttgatggaca agatcggctt agacacagtt       720
     gcgttcattg aagacaacta tatccaggaa agggggcttg acggaagcat gactgtggac       780
     tggctacgaa agagctatat cgatcaaggt cgactaggtc tgaagagtga aaaaggtgga       840
     ttgtacggac cgtcagccgc cgctgcacct gctgccgcta ccaaggcggc acagagtctg       900
     tacattctag atgtcggttt gggatcgaat aacaaggttg accagatccc cacagccggg       960
     aaaatcctct actttgatca gtctaccgga aatatgtcac caatcgtcac cggccagtca      1020
     ttgccagacg gggtggacgt atccaagtcc actggccgcc tcttctggac gaacatgggg      1080
     cgcgccacct caacgcgtga cggctcagta cactctgcga agctcgacgg gtcggatatg      1140
     cagaccctcc tgcccactgg atctgtgcat acaccaaaac agctagtggt ggatgacatg      1200
     aaccgcaaga tctacttctg cgaccgcgaa ggaatgggcg tgcaccggtg caactttgac      1260
     ggatcgggcc acgaagtcct catccagacg gggagcctag attgcgctga gcatcgcagc      1320
     gaccttacgc gctggtgtgt tggtatcgcc gtcgacaccc ctcacaggta catctactgg      1380
     acccagaagg gcccaagcaa ggcaggccgg ggccggattt tccgtgcggg ccttgagata      1440
     cctgccggtc agacagcgga gaacagaaca gatattgagt tgctgttgga cggtttacca      1500
     gagccgatcg atttggacct ggaggtgaaa tcacaaaagt tatactggac ggaccggggt      1560
     gagcacccca ttggctgctc gcttaactgt gtggatctat cagggtcaac tcagctcgaa      1620
     aaactcaagt cgaataagga gatccttgct cggcatttta atgagcccat cggtttgagg      1680
     gttgctggtg atggcactgt gtatctaatc aagaaatgtg ttatattgca aggatccgct      1740
     tctctctata aacaagattc cgacattacc caccgctcga gaaactatct atcctccatg      1800
     gcataa                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page