(data stored in ACNUC16935 zone)

EMBL: BN001307.PE155

BN001307.PE155       Location/Qualifiers
FT   CDS_pept        complement(join(430268..430270,430351..430513,
FT                   430556..431529,431583..431743,431792..431867))
FT                   /locus_tag="ANIA_08920"
FT                   /old_locus_tag="AN8920.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007946"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007946"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007946"
FT                   /db_xref="GOA:Q5AS10"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS10"
FT                   /protein_id="CBF84656.1"
FT                   /translation="MPSYTLEQVKAHCTPDDIWIILHNKVYEVTKYLEDHPGGSAVLIE
FT                   VAGADATEAFEEIGHSDEAREQLEPYYIGDLPDQEQAESVEIYRPTFEQVSQSAVINTK
FT                   KTSKSFSSLLSVLVKLGLTGAVGAATIAVFQKNWTPRQLLHALPALTTPIPLPRISGSG
FT                   GSQFWSGVGIATITQLSLSFGLGVWVSTKLDVQQEFTHYPPRRPASSARLIRLPSTTRA
FT                   LAPRSPVLDPRQWRSFPLTSKKEVAPNVYRLVFALPKADDILGLPTGQHVALRATVDGK
FT                   TVQRSYTPISNNTDRGHIELLIKVYPKGLLTNHLAQMEVGETIEMRGPKGAMKYSAQYA
FT                   YRIGMIAGGTGITPMYQLIRAICEDESDNTQVSLLYANNGEADILLREELESFAGRFPH
FT                   KFKMEGFVNGEMIAKHIGSPADDAKVLLCGPPPMVEAMKKTLAGMGWDMPGAIANGTDQ
FT                   "
     atgccttcct acacgcttga acaggtcaag gcccactgca caccggatga tatctggata        60
     atcctgcaca acaaggtcta cgaggtgacc aagtatctcg aagaccaccc tggtggaagc       120
     gccgtcctta ttgaagttgc cggggctgat gccacggaag cttttgagga gatcggccac       180
     tctgatgagg cgcgcgagca gctcgagccg tattatattg gtgatttgcc agatcaggaa       240
     caagccgagt ccgtcgagat ctatcgaccg accttcgagc aagtctcaca gtctgccgtc       300
     atcaacacca agaagacgag caagtccttc tcgtcgcttc ttagtgtgct agtcaagctc       360
     ggccttacag gtgcagtagg tgctgccaca attgcggtct ttcagaaaaa ctggacgccc       420
     cgtcagctat tgcatgctct ccctgcgctg accactccaa tcccgctccc tcggatatca       480
     ggcagcgggg gatcccagtt ctggtctggt gttgggattg ccaccatcac gcagctgtct       540
     ctatcctttg gtctgggcgt ctgggtgtcg accaagctcg acgtgcagca agagtttacg       600
     cactacccac ctcgacgacc agcgtcaagc gcacggctca tccgcctccc ttccactaca       660
     cgtgcgctgg caccgcgcag cccggtcctt gatccgcgcc aatggcgcag cttccctctc       720
     actagcaaga aagaagtcgc cccaaacgtg tacaggcttg tatttgccct ccccaaggcg       780
     gacgacatcc tcggactccc aacagggcag catgttgccc tccgcgcaac cgtcgatgga       840
     aagaccgtcc agcgcagtta cacgcccatc tcgaacaaca ccgaccgcgg ccacattgag       900
     cttctgataa aggtttaccc aaagggcctc ttgaccaacc acctagcgca gatggaggtc       960
     ggagagacga tcgaaatgcg cgggcccaag ggcgccatga agtactctgc tcaatacgcc      1020
     taccggatcg gcatgattgc cggcggaaca ggaatcacac ccatgtacca gcttatccgg      1080
     gcaatctgcg aagatgagtc cgacaataca caagtcagtc tgctgtacgc caacaacggc      1140
     gaggctgata ttctcctccg tgaggagctg gaaagctttg cggggcgttt cccacacaag      1200
     ttcaagatgg aagggttcgt gaatggggaa atgatcgcga agcatattgg gtcgccggcg      1260
     gatgatgcaa aggtattgct ctgtggacca ccgccaatgg tcgaggctat gaagaagacg      1320
     ctggccggca tgggctggga catgccaggg gcaattgcaa acgggacaga tcaatga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page