(data stored in ACNUC16935 zone)

EMBL: BN001307.PE158

BN001307.PE158       Location/Qualifiers
FT   CDS_pept        complement(join(436160..436295,436459..437594))
FT                   /locus_tag="ANIA_12277"
FT                   /old_locus_tag="AN11685.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010530"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00010530"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00010530"
FT                   /db_xref="GOA:C8VLJ5"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLJ5"
FT                   /protein_id="CBF84662.1"
FT                   /translation="MPLLFSFFLFVYLYISSSLFFDIVHFCLHQWSSSRYEALRWLSRC
FT                   HQFHHLYYNRSLNFNSRYRWQNSWFALPLEAACLCIGGLLGWFFLMLLPVIEQKHVLRT
FT                   PLIAILAVHIIRTSVVIYMSGQDSNHVVYKTVPKDPSWLFVGPQFHALHHVHPDRYMGS
FT                   VVKVFDWLAGTAYSLRNKSVVITGGSGALGSAIIRRLRSEGVRNVYSLKFGEHWTHGDF
FT                   NRVGPIFDHLEPDILILAHGTKGEDAMDANCNSTIRLIQLYLEQRAGRTPASATKTLPE
FT                   VWYIGSEVELHPAFGGAEMYRYLDSKRAFLPYARALYDDSGVVYRHIVPAAFQSRMGRA
FT                   IVSADWAAGVMMWWIRRGARYVPVTYTGFAYSNFFKFFCSRNTIDGVPVDSARVRPDRS
FT                   GIGVGRQRHGASSSSDVCRINPAL"
     atgcctctac ttttctcatt tttcctcttc gtttacctgt acatcagcag ctcgctattt        60
     tttgacatcg ttcacttttg cctgcaccaa tggtcaagct cgcgatatga agccctgcga       120
     tggctctctc gttgtcatca gttccaccat ctatactaca accggtccct aaacttcaac       180
     tccagatatc ggtggcagaa ttcatggttt gcattgcctc ttgaagcggc ctgcctgtgt       240
     atcggaggcc tactgggctg gttcttcctc atgctactcc cagtgatcga acaaaagcac       300
     gtactacgta ctccactgat cgctatcctt gccgtacata tcatccggac gtcagtcgtt       360
     atctatatga gcggccaaga ttcgaatcac gtcgtctaca agacagtccc gaaagacccc       420
     tcctggctgt ttgttgggcc gcagttccac gcactacacc atgttcatcc ggatcggtac       480
     atgggctcgg tggtcaaagt tttcgactgg ttagcgggga ctgcatactc tctgcgtaac       540
     aaaagcgtgg tcatcacagg agggtcagga gcgcttggat ctgcgataat tcgccggcta       600
     cggtccgaag gagttcggaa tgtatattcc ttgaaattcg gcgagcattg gactcatggc       660
     gatttcaatc gtgttgggcc catcttcgac catttggaac cagatattct cattctagca       720
     cacggcacca agggtgagga tgcaatggat gcgaattgca actcaaccat ccgtctcata       780
     caactctacc ttgagcaacg ggctggccga accccagcta gcgcaaccaa gaccctccct       840
     gaggtctggt acattggtag cgaggtcgag ctgcatcctg cgtttggagg cgccgaaatg       900
     taccgctatc tcgactcaaa acgggcgttt ctgccctacg cccgtgcatt atatgacgat       960
     tcgggggtcg tttatcgcca tatagttcct gctgcgttcc agtcacggat gggcagagcc      1020
     attgtgtctg ccgattgggc ggccggggtt atgatgtggt ggatacgtcg cggcgcccgt      1080
     tatgtcccag ttacctatac ggggttcgca tattcgaact tcttcaagtt cttttgctcg      1140
     cgaaatacta tagatggtgt tccagtggac tcggcccgag ttcggccgga tcggagcggg      1200
     atcggagtcg gccggcaacg gcatggagca tcgtcatcaa gcgacgtttg taggattaat      1260
     ccagctttgt ag                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page