(data stored in ACNUC16935 zone)

EMBL: BN001307.PE159

BN001307.PE159       Location/Qualifiers
FT   CDS_pept        441682..442767
FT                   /locus_tag="ANIA_08917"
FT                   /old_locus_tag="AN8917.4"
FT                   /product="DUF636 domain protein (AFU_orthologue;
FT                   AFUA_2G12650)"
FT                   /note="transcript_id=CADANIAT00007948"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007948"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007948"
FT                   /db_xref="GOA:Q5AS13"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS13"
FT                   /protein_id="CBF84664.1"
FT                   /translation="MSTKTLTIRCHCRSTHFALTVEPTSLPLRAHLCHCTLCRTTHGTT
FT                   ASYHAPLPEGVKPSFIAPSSWDNLTAYTPPGSGAKLYFCSTCGCQVGGTNVLGIWDTVV
FT                   SIIEGGNEEDAIWVIDEHIYTEKGSTGDGGIAELLPRIGERELRVWNPDIKGTEFPTAG
FT                   SGAAGRSASHNRQDDKLLAQCNCGGVSFTISRPREDFMNSPLSKGWIHPSFRTKWLALL
FT                   DVCDDCRLLTGAHVTTWLFVPIDHITPSLPDDLVIGTMKRYESTPGTVSRTFCGTCGAT
FT                   VFCYYDKRGGIVDIATGILRAPEGVMLGDWAVWRTAKLGFKDDGRRYDKLFTEGLEKGA
FT                   KEWGRRVHGEVIDFQGGPATD"
     atgtctacaa aaacactaac gatccgttgc cactgtcgtt ccactcactt cgcccttacc        60
     gttgaaccaa cctccctccc gctccgcgcg catctgtgcc attgcaccct ctgccgcaca       120
     acccacggca caaccgcctc gtaccacgct ccacttccag aaggagtaaa accctccttt       180
     atagccccct caagctggga taatcttact gcatacacgc cgcctgggag cggagcgaaa       240
     ctgtactttt gtagcacatg tgggtgccag gttggcggga cgaacgtgct cggaatatgg       300
     gatacggttg tctccatcat cgaaggcggg aacgaagaag atgcgatctg ggtgatcgac       360
     gagcatatct ataccgagaa aggctccacg ggcgatggtg ggattgcgga gctcttaccc       420
     cggatcggcg agagagaact gagggtctgg aatccagaca taaaagggac ggagtttcct       480
     actgctggta gcggtgctgc cggtcgttct gcgtcgcaca acagacagga cgacaagctt       540
     cttgcgcagt gcaactgcgg cggtgtctcg ttcaccatct cccgcccgcg cgaggacttt       600
     atgaactcgc cgttgagcaa agggtggata catccgtctt ttaggacaaa atggctcgcg       660
     ctgctggatg tctgtgatga ctgccgtctg ctgacaggcg cacatgtgac gacctggctc       720
     ttcgtgccga tagatcatat cacaccatcc ctcccggacg acctggttat tggaacgatg       780
     aagcggtacg agtcgactcc ggggaccgtc agccggacat tctgcgggac ctgcggcgcg       840
     actgtgttct gctattacga caaacgaggg gggatagttg atattgcgac ggggattctg       900
     cgggcacctg agggtgtgat gctgggtgat tgggccgttt ggaggactgc gaagctgggg       960
     ttcaaggacg atggccgcag gtatgataaa ctgtttacgg aggggttgga gaagggggcg      1020
     aaggagtggg ggaggagagt gcatggggag gttattgatt tccaaggagg accggcgact      1080
     gattag                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page