(data stored in ACNUC16935 zone)

EMBL: BN001307.PE16

BN001307.PE16        Location/Qualifiers
FT   CDS_pept        join(49259..49861,49909..50526,50596..50724)
FT                   /locus_tag="ANIA_09045"
FT                   /old_locus_tag="AN9045.4"
FT                   /product="Exo-polygalacturonasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5ARN5]"
FT                   /note="transcript_id=CADANIAT00007808"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007808"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007808"
FT                   /db_xref="GOA:Q5ARN5"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ARN5"
FT                   /protein_id="CBF84398.1"
FT                   /translation="MGFKRTIGLLLGILLALDQVSVLAQPGRPTFAKRPDIQPNPIQPY
FT                   KAIPLHSRRNSHKVCYVKPSLNGGDDAGRVEAALRRCNNGGTIVLDKEYSICTPLDLRF
FT                   LKHVDVALTGKVEFCPELEFWQQNVFQFHFQNASSWWVWGGEDIHLYGAGTGVIHGNGQ
FT                   PWWDAAAGNSSVRRPLLFITDGWHGGSITGLKLRQSPNWHNFIANSSDLLISDMDIFSR
FT                   SSSEAWASNLDGWDTFRSDNVVIQNSVINHDDDCVSFKPNSTNIIVQGLHCNGSHGISV
FT                   GSLGNYPYQYDIVSDLYIYNNTMANTTTAARLKVWPGAEAVKKGNPPWVGGGGKGYVRN
FT                   VTYDLMINDNNDLAIQIDQCYGAINASECLDHPSGVILTNVLFKNMWGTSNGANDPVAG
FT                   QLICGSADSCDNIRAENVTLTNSSGQPSEWQCRYMDEELLDLGGVGCIPA"
     atgggtttca aaagaacaat tggcctcttg ttaggcatcc tgctggccct cgaccaagtc        60
     tcagtgctgg ctcagcccgg tcgtcctacc tttgcaaaac gtccagacat ccaaccgaat       120
     cccatccagc cgtacaaggc aatccccctc cactctcggc gtaattccca caaggtatgc       180
     tatgtcaagc ctagcctcaa cgggggtgac gatgccggga gagtcgaagc tgcactgcga       240
     cggtgcaaca acggcgggac aattgtgctc gacaaggagt actccatctg cactcctctt       300
     gatctacgct tcttaaagca tgtggacgtc gccctgaccg gaaaggtcga gttctgcccc       360
     gagctggaat tctggcagca gaacgtgttt caattccatt tccagaatgc ctcctcctgg       420
     tgggtttggg gcggcgagga tattcacctc tacggcgcgg gcaccggtgt catccatggg       480
     aacggccagc cctggtggga cgcggccgca ggcaattcga gcgttagacg cccgttgcta       540
     tttattacag atggttggca cggcggttcc attaccggcc tgaagctgcg gcagtcaccc       600
     aactggcaca acttcatcgc caacagctcc gaccttctca tctctgacat ggatatcttc       660
     tcgcgctcat cgtcggaggc ctgggcatcg aacttggacg gctgggacac gttccgctca       720
     gacaacgtgg ttattcagaa ctctgtcatc aatcacgatg acgactgcgt ctcgttcaaa       780
     ccaaacagca ccaatattat cgtccagggc ttgcactgta acggctccca cgggatctcg       840
     gttggctcgc ttggaaacta cccgtatcag tacgatatcg tctcagacct gtacatctac       900
     aacaacacta tggccaacac caccacggca gcacgactca aggtctggcc aggcgctgag       960
     gccgtcaaga aaggcaatcc gccctgggtc ggtgggggag gcaagggata cgtgcgcaac      1020
     gttacctatg acctgatgat caatgataac aacgacctcg ccattcaaat tgaccagtgc      1080
     tacggggcca tcaatgcgag cgagtgcttg gatcacccgt ccggcgtcat tctgaccaac      1140
     gtactcttca agaatatgtg gggtacctca aatggtgcga atgatcccgt tgctggccag      1200
     cttatctgtg gttcagcgga ttcctgcgac aatattcgag cggagaatgt caccctgacg      1260
     aactccagtg ggcagccgtc ggagtggcag tgtagataca tggatgaaga gcttctggat      1320
     cttggtggcg tcggttgcat ccctgcatga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page