(data stored in ACNUC16935 zone)

EMBL: BN001307.PE161

BN001307.PE161       Location/Qualifiers
FT   CDS_pept        complement(join(449886..452659,452709..453723))
FT                   /locus_tag="ANIA_09426"
FT                   /old_locus_tag="AN9426.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007949"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007949"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007949"
FT                   /db_xref="GOA:Q5AQK4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK4"
FT                   /protein_id="CBF84668.1"
FT                   /translation="MRPKSRSDFTVAVICALPLEADAVEALFDEHYDRLGEYYGKQPGD
FT                   ANAYLNGRIGNHNVVLCYMPGIGKESAASVASSLQVSYTEIKLALVVGICGGAPSPPVY
FT                   QEIFLGDVMISDSVIEYDFGRQYPGGFQQKSAVKDILGRPSQEIRALLNGLRAENARNE
FT                   FQSQIREHLHVLQQRGAKWHRPYIKDILFNASYLHKHYSDAPAGCSCLRSNSPDEICEM
FT                   ALEEDCDSLGCDKKQAVRCRKTLENIQPSVYVGPIASADTVMKSGQYRDELVRKEKVIG
FT                   FEMEGAGVWDNLPCIIIKGVCDYADSHKSKSWQAYAAATGASAAKAFLKYWMSANRKGA
FT                   NRSRNRHLVIPFGRNSRFVGRQDEIHKLESLIFMPDGPRKLAITGLGGVGKTQVALELA
FT                   YRMRDREADCSIFWVPCTSYEVAEQALLSIAQRVEIQDTQPEKLKERLKTYFGQEDKNW
FT                   LLIFDNADDMDMWTKGSNDTPPLKDFLPLNNQGHIIFTTRNRELAVDLASPYVMQVPEL
FT                   DRKTGMEFLEKSLCKDLLHDSHAMIRLLEQLTFLPLAISQATAYINKKGLKVSDYLTLL
FT                   EEQETDVVELLSKDFGDDQRYTDVQNPVAKTWLISFKQIQKLDQLAVEYLLLMACINPR
FT                   NIPQAFLPPRSKLQMSDALGLLNAFFFITIQPENGYISLHRLVHLATRNWMRKEGWFPL
FT                   WITKTTDRLSSIFPHNDHANRQVWREYLPHALSLLRETEFHKHQEQYVDYIEKVGTCLD
FT                   SDGRYNEAEKLQAQVIEARKKVLGPEHPSTLTSVHNLASTYRNQGRWSEAEELQEQVIK
FT                   TWKQVLGLKHPFTLTSMGNLALIYWNRGRWKEAEELLAQVMENRKQVLGLVHPDTLASV
FT                   HNLAATYLDRGRWKEAEELFVQLVETRKQVVGLEHPDTLTSMHNLASTYRNQGRWKEAE
FT                   ELLTHILEAWKRVMGSEHPSTLTSMHNLASIFWCQGRWKEAEELLTEVIETRKRVLGPE
FT                   HPDTLSSLHNLASRYLDIGHWKEAEGLLAQVMETRKQVLGPAHPSTLTCMHNLASAYQN
FT                   QGRLEEAEELQVRVMEAWKQVVGSKHPSTLTSMDNLATTYRKQGRWNEAEELQVQVMET
FT                   WTQVLGPEHPDTLISMANLASLYYNQGQWNKAEKLQVQVMETRKQVLGPEHPHTLTSML
FT                   NLAFTFKNLGNNLDALRLIKGYAGLCNKVLGSNHPQAILSLSTLNEWESEAEQLTKGQK
FT                   QQTLADTSSSLALPQSYAGEQGASELKTAGGKRRRLS"
     atgcgcccga aaagccgcag tgattttaca gtcgctgtta tttgcgccct tccccttgag        60
     gctgacgctg tcgaagccct ttttgatgag cattatgacc gcctcggaga gtactatggc       120
     aaacagccag gcgacgcgaa tgcatactta aatggaagga taggcaatca taatgtagtt       180
     ttgtgctaca tgccaggaat tgggaaagaa agtgcagcaa gtgttgcctc cagcttgcaa       240
     gtcagctata cagagatcaa gcttgcatta gtcgttggta tctgtggagg ggccccttct       300
     ccgccagttt accaagaaat attcctaggt gatgtcatga tcagtgattc tgtgattgaa       360
     tatgactttg gcaggcagta tcctggcggt tttcaacaaa agagtgctgt caaggacata       420
     ctgggtaggc caagtcagga gatccgggct cttctgaacg gccttagggc cgaaaatgct       480
     cgcaatgaat ttcagagcca gatacgagaa catctccatg ttctccaaca aagaggggcc       540
     aagtggcatc gtccatatat caaggatatc ctttttaatg cctcttatct tcataagcat       600
     tactctgatg ctcctgcagg gtgctcctgt cttaggagta actcgcctga cgagatttgt       660
     gaaatggcat tagaggagga ctgtgatagc cttggatgtg acaaaaaaca ggcagttcga       720
     tgtcgaaaga ccttggaaaa tatccagccc tctgtatatg ttggacccat cgcttctgct       780
     gatacggtga tgaagtctgg gcagtaccgt gatgagcttg tcagaaaaga aaaggttatt       840
     ggctttgaaa tggaaggggc aggggtgtgg gataatcttc catgtatcat tatcaaaggg       900
     gtctgtgact atgctgatag tcacaagagc aagtcatggc aagcatacgc agcagcaact       960
     ggagcctcgg cagcaaaagc attcttgaag tactggatgt ctgcaaaccg caaaggtgca      1020
     aacagaagca gaaaccgtca cttggtgatc ccctttggga gaaattcccg ctttgtgggc      1080
     cgccaggatg agatccataa gttggaaagt ttaatcttca tgcctgatgg accgagaaag      1140
     cttgccatta ctggtttagg aggagttggc aagactcaag tagcccttga gctagcgtac      1200
     cgtatgcggg acagagaggc tgactgttca attttttggg tcccatgcac cagttatgag      1260
     gttgctgaac aggccctttt gtccattgct caaagagtag agatccaaga cacgcagcca      1320
     gaaaagttga aagaacgcct caagacttac ttcggccaag aagacaagaa ttggcttctg      1380
     atattcgaca atgcagatga tatggatatg tggaccaagg gcagcaacga cactccacca      1440
     ttaaaggact ttcttccctt aaacaatcaa ggccatatca tctttactac tcggaataga      1500
     gaactagccg tggacttagc ctctccttat gtgatgcaag tccctgaact tgacagaaaa      1560
     actggcatgg agttcctgga aaagtctctt tgcaaggacc tgcttcatga ttctcacgcc      1620
     atgattcgtc tgcttgaaca gcttactttc cttccgttgg ctataagcca ggccactgca      1680
     tatatcaaca aaaagggtct gaaagtgtct gattacttga cccttctgga ggaacaggag      1740
     acagatgttg tggagctcct tagcaaggat tttggtgatg accaacgcta tacagacgtg      1800
     cagaatccgg tagcgaaaac atggctgata tcattcaaac agattcagaa gctagaccaa      1860
     ctggctgttg aatatctatt actcatggcc tgcattaatc cacgcaatat cccgcaagcc      1920
     tttcttccac cacgatcaaa gctgcagatg agtgatgctc ttggactttt aaatgctttc      1980
     ttttttataa ctatacaacc tgaaaatggc tatattagcc tccatcgctt ggtgcatcta      2040
     gcaactcgaa actggatgag gaaggaggga tggttcccac tctggataac caaaacaaca      2100
     gaccgattaa gttcaatttt tccgcataac gaccatgcca accgacaagt ttggagggaa      2160
     tatctccccc atgcgctttc cttattgaga gagacggagt ttcataaaca tcaagagcag      2220
     tacgttgact acatagaaaa agtggggacc tgtttggata gtgatggaag gtataatgag      2280
     gcggaaaagc tgcaggccca ggtgatagag gcccgaaaaa aggtacttgg gccagagcat      2340
     ccttctactc tgaccagtgt gcacaacctt gcatcaacat atcggaacca aggacgatgg      2400
     agcgaagcag aagagctgca ggaacaggtg ataaagacct ggaaacaggt gcttgggcta      2460
     aagcatcctt ttacgctgac cagcatgggc aacttggcct taatatactg gaatcgagga      2520
     cggtggaagg aagcagaaga gctgctggcg caggtgatgg agaatcggaa acaggtactt      2580
     gggctggtgc atcctgacac tctcgccagc gtgcacaacc tagcagcaac atacctggat      2640
     agagggcgat ggaaggaagc agaagagtta tttgtgcagc tagtagagac ccgaaaacag      2700
     gtggtggggt tagagcatcc cgacactcta accagcatgc acaacctggc atcaacatac      2760
     cggaaccaag ggcgatggaa ggaagcagaa gagttattga cgcacatact ggaggcctgg      2820
     aaacgggtga tggggtccga gcatccttcc actctaacca gcatgcacaa tctagcctcg      2880
     atattttggt gccaagggcg atggaaggaa gcagaagagc tgctgacgga ggtgattgag      2940
     acccgtaaac gggttctagg gccagagcat cctgacactc tttccagcct gcacaacctg      3000
     gcatcaaggt acctggatat agggcactgg aaggaagcgg agggtctgct ggcgcaggta      3060
     atggagacca ggaaacaggt attaggacca gcacatcctt ctacattgac ctgtatgcac      3120
     aacctggcat cagcatacca gaaccaggga cgattggagg aagcagaaga gttgcaggta      3180
     cgagtgatgg aggcctggaa acaggtggta gggtccaagc atccttccac cttaaccagt      3240
     atggacaacc tggcaaccac ataccggaag caaggacgat ggaatgaagc agaagagttg      3300
     caggtacagg tgatggagac gtggacacag gtcctagggc cagagcatcc cgatacacta      3360
     atcagcatgg ccaaccttgc atcattatac tataatcaag gacaatggaa caaagcagaa      3420
     aagctacagg tgcaggtaat ggagactcgg aaacaggtgc tagggccaga gcatcctcac      3480
     acgctaacca gcatgctcaa ccttgccttt acattcaaga atctgggaaa taacctagat      3540
     gccctgcggc ttattaaggg ttatgcgggc ctctgcaaca aggtgttagg ctcaaatcat      3600
     ccgcaggcta tactctcgct cagtaccctt aacgaatggg aatctgaagc ggaacagctc      3660
     acaaaaggtc agaaacaaca gactttagca gacacttcct cttccctagc actgccgcag      3720
     tcttatgccg gtgaacaagg tgcatcagaa ttaaaaactg caggcggcaa acggcggcga      3780
     ttatcatga                                                              3789
//

If you have problems or comments...

PBIL Back to PBIL home page