(data stored in ACNUC16935 zone)

EMBL: BN001307.PE164

BN001307.PE164       Location/Qualifiers
FT   CDS_pept        complement(join(462097..462525,462590..463189,
FT                   463249..463508,463585..464112,464163..464166))
FT                   /locus_tag="ANIA_08915"
FT                   /old_locus_tag="AN8915.4"
FT                   /product="hypothetical peptide transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007952"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007952"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007952"
FT                   /db_xref="GOA:Q5AS15"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS15"
FT                   /protein_id="CBF84674.1"
FT                   /translation="MEPVLNEKTGAPAVEDVVAVSDYEEPTEEELKTLRRIPGALPTVA
FT                   YLICIVEFCERASYLGVSGLISNFVNRPLPAGGNGYGAPARGTQDTAGALGMGTVKANA
FT                   VSQSFSMLAYLLPMFFGYLSDAHTGRFKMILYGVAVFGVAHVLMVGATAPKLLANGGAK
FT                   APYFISLYMLSVGASMFKPNVSPLLLDQMPRDKAKIKVLPSGERVIVDPEATSERTMLW
FT                   FYLLINIGGFMQTATSYAEKYVGWWLAFILPLFLYIPLPLLLIWLRKRLVLFPPGGSDL
FT                   PNVVRVLKICLSRGGIFRIGRHGFWDAAKPSVIAAKGQNIRTQWNDQFVEDVRRTFQAT
FT                   GIFCFFPIQYINDNGLGSAASFLSTMLKTDGVPNDLISNFNPLSIIFFAPILNYGLYPL
FT                   LRRWKIHYGPVARMATGLFISSIGGIGYTVLNYYAYKLGPCGKWGSSDTCVDENGNTRV
FT                   APITIWWIAIPYAIGGISELFINVPAYGIAYSRAPKNMRGLVSAINLLNTAVAYAIGLA
FT                   CSAVIKDPYLTWDFGGPSIVGFVLTVIFYFMFRHIDKEEYFLTEMAENENETTAQPKES
FT                   ALSENGDKTLSPVEKVADNEPEKIGVSLKQ"
     atggagcccg tcctcaacga gaagaccggc gcgcccgccg tcgaagatgt cgtcgccgtc        60
     tccgattatg aagagccgac cgaggaggag ctcaagacgc tccgccgcat ccccggcgcc       120
     ctcccgaccg tcgcctacct tatctgtata gtagaattct gcgagcgcgc ctcgtatctg       180
     ggagtctccg gtctcatctc caacttcgtg aaccggcctc tccctgcggg aggcaatggt       240
     tacggcgcgc ctgcgcgcgg gacccaggac acggctggtg ccctgggcat gggcaccgtc       300
     aaggcgaatg ccgtcagcca gtcattcagt atgctcgcgt acctgctgcc catgttcttt       360
     ggctacctct ccgatgcgca cactggacgt ttcaagatga tcctctacgg tgttgcggtc       420
     tttggtgttg cgcacgttct catggtcggt gctacggcgc ccaaactgct ggccaatggg       480
     ggtgcaaagg cgccgtactt tatctcactg tatatgctct ctgtcggtgc ttccatgttc       540
     aagcccaacg tatcccccct cctcctcgac cagatgcctc gcgataaagc caagatcaag       600
     gttcttccca gcggcgaacg ggtcattgtc gacccggagg ctacttctga gcgaaccatg       660
     ctatggttct acctgctcat caatatcggc ggcttcatgc agaccgccac ctcgtacgct       720
     gagaagtacg tcggctggtg gttggctttc attctgcctc tgttcctcta catccctctg       780
     ccccttcttc tgatctggtt gcgcaagcgc ctcgtcctct ttccccctgg aggaagcgac       840
     cttcccaacg tcgtgcgcgt gctgaagatc tgtctctctc gcgggggcat cttccgcatc       900
     ggccgccacg gcttctggga tgccgcgaaa ccgtcagtga ttgcggcgaa agggcagaac       960
     attcgcacac agtggaacga ccagttcgtc gaggacgtgc gacgcacctt tcaagcgacc      1020
     gggatcttct gcttcttccc gatccagtac atcaacgaca atggcctcgg cagcgccgcc      1080
     agtttcctct ccactatgct caagacggat ggagtgccaa acgacctgat ctcgaacttc      1140
     aacccgctca gcatcatctt cttcgcgccg atcctgaact acgggcttta cccgttgctg      1200
     cgccggtgga agatccacta tggccctgtg gcacgcatgg caactggtct cttcatctct      1260
     tccattgggg gcattggata cactgtgctc aactactacg cgtacaaact tggtccctgc      1320
     gggaaatggg ggtcctcgga tacttgcgtt gatgagaacg ggaatacgcg cgtggcaccg      1380
     atcaccatct ggtggatcgc cattccctac gccatcggtg gcatctctga gctcttcatc      1440
     aacgtccccg cctacggcat cgcctactcc cgcgccccca agaatatgcg cggcctcgtc      1500
     tccgccatca acctcctcaa cacggcagtc gcctatgcca ttggactggc ctgctcggcc      1560
     gtgatcaagg acccttatct gacttgggac tttggcggcc cgtccattgt aggctttgtc      1620
     ctcactgtca tcttctactt tatgttccgc cacatcgaca aggaggagta cttcctcacg      1680
     gagatggcgg agaacgagaa cgagacgact gcccagccta aggagagcgc gctgagtgag      1740
     aatggggata agacattaag ccccgtagag aaggttgctg ataatgagcc ggagaagatt      1800
     ggggtatccc taaaacaatg a                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page