(data stored in ACNUC16935 zone)

EMBL: BN001307.PE165

BN001307.PE165       Location/Qualifiers
FT   CDS_pept        complement(join(466493..466704,466759..466897))
FT                   /locus_tag="ANIA_08914"
FT                   /old_locus_tag="AN8914.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007953"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007953"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007953"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS16"
FT                   /protein_id="CBF84675.1"
FT                   /translation="MPSCAVAHAIGNVRKPGIALLFAPEQPMVKEHDVKKWHVVYQNRF
FT                   DCWEGPLRIQGTSAFREMEAYNLERRISMYDQAEWVADLNVLKSLGQSLICECVVSMVN
FT                   IAVMIHPCQRAK"
     atgccttcat gtgctgttgc gcatgctatc ggtaacgtga gaaagccagg gatagcgctc        60
     ctttttgcgc ctgagcagcc gatggtcaaa gagcacgatg tcaagaagtg gcacgtggtg       120
     tatcaaaacc gattcgattg ttgggaagga cctctgagaa tccaagggac ttcagcattc       180
     agagaaatgg aagcgtacaa tttggagagg cgaatctcca tgtacgatca agcagaatgg       240
     gtcgccgact tgaacgtcct caagtctcta ggccagtccc tgatctgcga gtgtgtggtg       300
     tccatggtaa acattgcagt catgatccat ccatgtcagc gtgcgaagta g                351
//

If you have problems or comments...

PBIL Back to PBIL home page