(data stored in ACNUC16935 zone)

EMBL: BN001307.PE166

BN001307.PE166       Location/Qualifiers
FT   CDS_pept        join(470132..470250,470325..470799)
FT                   /locus_tag="ANIA_08913"
FT                   /old_locus_tag="AN8913.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007954"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007954"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007954"
FT                   /db_xref="GOA:Q5AS17"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS17"
FT                   /protein_id="CBF84677.1"
FT                   /translation="MKPWILAFLALSACALAQETETPGPSPTESVGCEPHGDHWHCDAP
FT                   ATSTETDLESTSETLPPSPTESIGCEPHGDHWHCDAPATTTESESESDATSTSTTTATD
FT                   GEASESESASLSPSPTESVGCEPHGDHWHCDGPAETESASSDSSSSAAADATATDEAGA
FT                   EETGGEQPEDGAGIVGVKLSGVVAMAIGAAAVLL"
     atgaagccct ggattctcgc cttcctagcc ctatcagcct gcgctctggc ccaggagacc        60
     gaaacacccg gtccttctcc caccgagtct gttggctgtg aaccgcacgg agaccactgg       120
     cactgcgacg ccccagcaac atctacagag actgatttgg agtcaacctc tgagaccctg       180
     ccaccaagcc ctacagagtc gattggctgc gaaccgcatg gagaccactg gcactgcgat       240
     gcgccagcca caacgaccga gtccgagtcc gagtccgatg caacatccac ctctaccacc       300
     actgccactg acggcgaggc atctgagtcc gaatctgcca gcctctcgcc gagcccaact       360
     gagtccgttg gctgtgagcc acatggagac cactggcact gcgacggtcc tgctgagacg       420
     gagagtgcga gcagtgacag tagcagctca gctgcggccg acgccactgc tactgacgaa       480
     gcgggtgccg aggagaccgg tggcgagcag ccagaagacg gagccgggat tgtcggtgtg       540
     aagttgtcgg gtgtggtggc tatggccatt ggggccgctg ctgtgctgct gtaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page