(data stored in ACNUC16935 zone)

EMBL: BN001307.PE168

BN001307.PE168       Location/Qualifiers
FT   CDS_pept        complement(join(474152..474403,474469..474841,
FT                   474888..475624,475700..475807))
FT                   /locus_tag="ANIA_08911"
FT                   /old_locus_tag="AN8911.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007956"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007956"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007956"
FT                   /db_xref="GOA:Q5AS19"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS19"
FT                   /protein_id="CBF84681.1"
FT                   /translation="MAEPKPSTSYIESVGDEKAISYDPKETEEYDPNDPQNWSTVSRLT
FT                   TYLTICFYTFLANVNSSNFTVATKAIVQEFGVSQTQAGELVCFNVFLFGLGNIFWVPLM
FT                   RVVGKRPVYLTSMLLLCMMNVWSSRASSYGELLSSRILSGFAAAAADATVPAVVSDMVA
FT                   PQDRGHYLMVFHLALTSGLFIGPLINAYLVQEENWRWMCYFLAVAVGVVFVTAIFTVRE
FT                   TTYRRDRPRSGRRTPWQWMSLTLGYNPDASFVRTLLDIVWNVGYPQLLWAAFAIGISVG
FT                   WNIVVQLTASRTFTAPPYNWSAGSLGLLSLSGFIGSVLAFYLGGRLIDIISTRYTKRSG
FT                   QRLPEYRLPAIVIPGVIGPGGLLIFGLCIAHQVHWIGAAVGYAMQAFGVAAISNVAVTY
FT                   CLDCYKPLTGEALVIIFVIRNTIGMLLSLYAADWITQQGPAAVFGEMTAIQAASILLAI
FT                   PLFSWGGPLRAWTSRYGPMKRFMSAGENRCL"
     atggccgagc caaagccctc gacgagctat atcgagtctg ttggtgacga gaaagccata        60
     tcttatgacc caaaagagac tgaagaatac gatccaaatg atcctcagaa ttggtcgacg       120
     gtctctagat tgacgacgta cctcaccatc tgcttctata ccttcctcgc caatgtcaat       180
     agcagtaact tcacagtggc tacaaaggcc attgttcagg aattcggcgt ctcccagacc       240
     caagccggcg agttggtgtg cttcaacgtc ttcctgtttg gtctgggaaa tatcttctgg       300
     gttccattga tgcgagtggt ggggaagcgg ccagtatacc tgacgtcgat gctgctgctc       360
     tgtatgatga atgtatggtc cagtcgtgca tcgagttatg gcgaactgct ctcgtcgcgg       420
     atcctctctg gcttcgcggc ggcggcagca gacgccaccg tgcctgcagt ggtgtcggat       480
     atggttgctc ctcaggaccg aggtcattac ctcatggttt tccacctcgc tcttacgagc       540
     ggtctgttta tcggtccgtt gatcaacgcg tacctcgtgc aagaggagaa ctggcggtgg       600
     atgtgctatt ttctagccgt cgctgttggt gtcgtctttg tgacggctat ctttacagtg       660
     cgggagacaa cgtatcgtcg agatcgaccc cgttcaggca gaaggactcc atggcagtgg       720
     atgtcgttga cgttggggta taaccctgat gcttcgtttg ttaggacgct gctcgacatt       780
     gtttggaacg tgggataccc gcagctcttg tgggctgctt ttgccattgg catatccgtt       840
     ggatggaaca tcgttgtcca gctgacagct tcgagaacat tcactgctcc tccgtacaac       900
     tggtcggcgg gaagcctagg tctgctctcg ctctctggat tcatcggctc cgtgctggct       960
     ttctacctcg gtggccgtct gattgatatc atctcgactc gatatacaaa gcgctcaggc      1020
     cagcgtttgc ctgaataccg tctacccgcc atcgtgatcc ctggtgttat aggaccaggc      1080
     ggactcctga tcttcggact atgtattgca catcaggtcc actggatcgg agccgctgtt      1140
     ggatatgcta tgcaggcttt tggcgtcgcg gcgatttcca atgtcgctgt tacctattgt      1200
     ctggattgtt ataaaccgct caccggtgag gccctggtca tcatctttgt catccgcaac      1260
     acaataggca tgctgctttc cctctatgct gccgactgga tcactcagca aggacccgct      1320
     gcggtgtttg gcgagatgac cgctatccag gcggccagta ttcttctagc aatcccgttg      1380
     ttctcctggg gcgggccgct ccgggcgtgg acctcacggt atgggcctat gaagaggttc      1440
     atgagcgcgg gtgagaaccg atgcttatga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page