(data stored in ACNUC16935 zone)

EMBL: BN001307.PE17

BN001307.PE17        Location/Qualifiers
FT   CDS_pept        complement(join(50772..51099,51297..51568))
FT                   /locus_tag="ANIA_09044"
FT                   /old_locus_tag="AN9044.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007809"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007809"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007809"
FT                   /db_xref="GOA:Q5ARN6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN6"
FT                   /protein_id="CBF84400.1"
FT                   /translation="MAPLLERTVTAEKANGGWPDKVYAPSALAYNQAYLVSPAMTVQQI
FT                   RDFKQAFDDAALRSVKAGLDLVEIHAAHGYLLHQFLSPVSNSQADEVDFLDVSSGGIRA
FT                   KQETSIKSGDGYRAPFALEIKRAVGNVLLVCMVGGVKKTGEIAERFLQQGLDVVMCGRW
FT                   FQKNPGLVYQFADELGVKINMSTQYGRAFQGGRNRR"
     atggcgcccc tcttggagag gaccgttacg gcagagaagg caaatggggg ctggcccgac        60
     aaggtctatg caccgtctgc gctcgcttat aatcaggctt atctggtctc tcctgcaatg       120
     accgttcagc agattcgtga cttcaaacag gcctttgacg acgctgcgct gcggtcggtc       180
     aaggctgggc tcgacctggt cgagattcat gcagcgcatg ggtaccttct tcatcaattt       240
     ctgagccccg ttagcaacag tcaggccgat gaagttgact ttttggacgt cagctcaggg       300
     ggtattcgcg ccaagcagga aacgagtatt aaatctggcg acggataccg ggcgccgttt       360
     gccttggaga ttaaacgggc tgtggggaat gtcttgctcg tgtgtatggt gggaggtgtt       420
     aagaaaacag gtgagattgc cgaacgattc cttcagcaag ggctggatgt tgtgatgtgt       480
     ggtcgatggt tccagaaaaa ccctggcctc gtctatcagt ttgcagatga gcttggagtg       540
     aagatcaata tgtcgaccca gtatggacgg gctttccaag gtggaagaaa taggagataa       600
//

If you have problems or comments...

PBIL Back to PBIL home page