(data stored in ACNUC16935 zone)

EMBL: BN001307.PE170

BN001307.PE170       Location/Qualifiers
FT   CDS_pept        join(488493..489246,489298..489620)
FT                   /locus_tag="ANIA_08909"
FT                   /old_locus_tag="AN8909.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007958"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007958"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007958"
FT                   /db_xref="GOA:Q5AS21"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS21"
FT                   /protein_id="CBF84685.1"
FT                   /translation="MDHLNLSPPQSLIQNLELCVSNDHISSLTPDLLLHIFGYLREDGR
FT                   SLCNYALVCRRWQKLLEPLIYNTIQVYNEAPTPPRAFSVVRFKHFVGGLNNVRRRAMVR
FT                   KLVFHYQATQFPRGPGETASRAQDPAQNPTDAGFRKAVAGLFQTLRFWEPWYKIELDIA
FT                   LAYSYTGAPRLASMANPSTTADLVTFPTVHCVAEIAFHYSEHGQVFQRIWEATPFHIAQ
FT                   SCANLASLVMDSDAFKLTGRQAPVIRRRKVIAECLDGLPATIENFSMRVIGVSNPYVLD
FT                   WFTPEEDPFSCKLLRITTHLHAIKLYNVTIPVDFWCPLDKNYRPKRDRPVWPCLTHILS
FT                   DDNCLVEGTGKLVLVRLI"
     atggatcatc ttaacctgtc tccgccgcaa tcgttgatcc agaatctaga actgtgcgtc        60
     agcaatgacc atattagcag ccttacgcct gacttattac tgcacatctt cggatacctt       120
     cgagaagacg gtagatcgct ttgcaattat gcccttgtgt gccgccgttg gcaaaagctg       180
     ctcgagcctt tgatctacaa cacgattcaa gtatacaacg aagcccctac accacctcgc       240
     gctttctcgg tagtcagatt caaacacttt gttgggggtc tcaataatgt gagacgaagg       300
     gccatggttc gcaagctagt ctttcattac caggctaccc agtttcccag aggaccgggc       360
     gagaccgcgt cgcgagctca ggaccctgcg cagaatccca ctgatgcagg tttcaggaaa       420
     gcagtcgctg gactctttca aacattgcgg ttctgggagc cttggtacaa gatcgagctt       480
     gatattgctt tggcgtatag ctacacaggc gcaccacgac tggcatccat ggcgaacccg       540
     tcaactacgg ctgacttggt cacttttcct actgtccatt gtgtggctga aatcgctttc       600
     cactacagcg aacacggaca ggtgtttcaa cgtatttggg aagcgacacc gttccatatt       660
     gcccaatcct gtgcgaatct ggcttcgcta gtgatggatt cggatgcatt taagcttacc       720
     ggccgtcagg ctcccgtgat aaggcgacgc aaagtcatag ctgaatgctt ggacggcttg       780
     cctgccacca tcgagaattt cagcatgcga gtcataggcg tcagtaatcc gtacgtcctc       840
     gattggttca cccctgagga ggatcccttc tcttgcaagc tgttacgcat caccactcac       900
     ctccacgcga tcaaactgta caatgtgact atacctgttg atttttggtg cccgctcgat       960
     aagaattaca ggcccaaaag ggatcgccct gtctggccct gtcttaccca tatactttcc      1020
     gacgacaatt gtctcgttga aggcacgggt aagctagtcc ttgtccgtct catttag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page