(data stored in ACNUC16935 zone)

EMBL: BN001307.PE171

BN001307.PE171       Location/Qualifiers
FT   CDS_pept        490992..491828
FT                   /locus_tag="ANIA_08908"
FT                   /old_locus_tag="AN8908.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007959"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007959"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007959"
FT                   /db_xref="GOA:Q5AS22"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="InterPro:IPR039516"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS22"
FT                   /protein_id="CBF84686.1"
FT                   /translation="MKFPLPLPTLLGALTLLTPAFSANTLNIVAHPDDDLLFLNPDIQN
FT                   DISSGFNVRTVYLTSGDAGQPYEYWTLRQAGLLTAYAQMAGVESIWDESDAGVAGKDIP
FT                   VYTLRPKPEVSLAFMHIPDGSMDGNGFPATGQESLEKLWKGAIARIRTVDASGTTYSRG
FT                   ELVETLRQIIDSFVPDSLNSLDYVHPYGSGDHSDHTSAGLFTNTAAITSSFPGSVIAYR
FT                   GYPIKSEPANVGGEDLVRKKEVFYTYAAFDEDVCGSDQACAGKEYELWLPKQYTAN"
     atgaaattcc cactcccact acccaccctt ctcggcgctc tgacgctgct cactccagcc        60
     ttcagcgcaa ataccctaaa catagtcgca cacccggacg acgacctcct ctttttgaac       120
     ccagatatcc aaaatgacat ctcgtccgga ttcaacgtgc gcactgtgta cctaacctca       180
     ggcgacgcag gccagccata cgagtactgg acgctgcgac aggctgggct tctaacagca       240
     tacgcgcaaa tggcaggtgt cgagagcatc tgggacgaga gcgacgcggg ggttgccggc       300
     aaggatatcc cggtgtatac actgcggccc aagccagaag tgagtcttgc gttcatgcat       360
     attcccgacg ggagcatgga tgggaatgga ttccccgcga cggggcagga aagcctagag       420
     aaattgtgga agggggcgat tgcgcggatc cgcacggtcg atgcgtctgg gacgacgtac       480
     tcgcgaggcg agcttgttga gacgttacgg cagattattg actcctttgt gccggatagt       540
     ctgaattcat tggattatgt gcatccgtat gggagtggag atcatagtga ccatacgtct       600
     gcgggtttgt tcacgaatac ggcggcgatt acgtcgagct ttccgggaag tgttattgcg       660
     taccggggat atccaatcaa gtcggagcca gccaatgtgg gcggagagga tctagtgagg       720
     aagaaggagg tgttctatac ttatgcggcg ttcgatgagg atgtttgtgg gagtgaccag       780
     gcttgtgctg ggaaggagta tgagctttgg ctgccgaaac agtatactgc gaactga          837
//

If you have problems or comments...

PBIL Back to PBIL home page