(data stored in ACNUC16935 zone)

EMBL: BN001307.PE173

BN001307.PE173       Location/Qualifiers
FT   CDS_pept        complement(join(496668..496707,496823..497359,
FT                   497483..497625))
FT                   /locus_tag="ANIA_08906"
FT                   /old_locus_tag="AN8906.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007961"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007961"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007961"
FT                   /db_xref="InterPro:IPR031818"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS24"
FT                   /protein_id="CBF84689.1"
FT                   /translation="MCSQTQTSHDPQPQSNMIKRLSARISLRWPPEPPFENTDTLVLSV
FT                   GNCMKDEVLFTHELDSRNAFGVADCGTFSALPNGDDLEVGVMPRPDLPGAPVREYEEVW
FT                   RELPFVRMEGHENVSFVLESATGGTQLKEGEEKEITRTFIGAIWGSFIALRQTQVLARP
FT                   IGETRTVIKSGAEVSAKREDFVQGQGFVVRYSLGPEADELPTHSDIQLPASDGSLEKLV
FT                   VCGQDLHPQGKDVTVKE"
     atgtgctcac aaactcaaac ctctcacgac ccccaaccgc agtcaaacat gataaaacgc        60
     ctctcagcca gaatctccct gcgatggcca ccagagcccc catttgagaa cacggacacc       120
     cttgtcctct ccgtgggaaa ctgcatgaaa gatgaggtcc tcttcacgca cgaactggat       180
     tcacgaaatg cttttggtgt cgccgactgt gggacgttct cagcgctccc gaacggtgac       240
     gacctggagg ttggagtcat gccgcgaccc gatctgcccg gcgcaccggt gagggagtat       300
     gaggaggtat ggagggagtt accgttcgtg cgaatggaag gacatgagaa cgtgtctttt       360
     gtgcttgaga gcgcgacggg ggggacgcaa ttgaaggaag gcgaggagaa agaaatcacc       420
     cgaaccttta tcggcgcgat ttggggatca tttattgcac ttcgacagac acaggtactt       480
     gcgagaccca ttggagaaac taggactgtg atcaagagtg gtgcagaagt cagtgcaaaa       540
     cgggaggatt ttgttcaagg gcaagggttc gttgtgaggt actcgctcgg tccggaggca       600
     gacgaattgc ccacccactc ggatatacag cttccagcgt cggatggctc tcttgagaaa       660
     ctagtggttt gtgggcagga tcttcatcct caagggaaag acgtcacggt caaagagtga       720
//

If you have problems or comments...

PBIL Back to PBIL home page