(data stored in ACNUC16935 zone)

EMBL: BN001307.PE175

BN001307.PE175       Location/Qualifiers
FT   CDS_pept        complement(join(500484..500831,500894..501031,
FT                   501100..501558,501604..502076,502122..502401))
FT                   /locus_tag="ANIA_11149"
FT                   /old_locus_tag="AN11149.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007963"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007963"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007963"
FT                   /db_xref="GOA:C8VLL2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012083"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLL2"
FT                   /protein_id="CBF84693.1"
FT                   /translation="MKLSSLVALVGVSALSEASPRPKPNFVFVFTDDQDLTMNSVEYMP
FT                   HVAGRIRDRGLDFTNHFVTTALCCPSRVSLWTGRQAHNTNVTWVAPPYGGYPKFVSQGF
FT                   NEDWFPLWLQDAGYNTYYVGKLFNAHSVTTYNNPFVKGFNGSDFLLDPFTYSYWNSSYQ
FT                   RNHEAPKSYAGQYTTDVTEEKALGFVDDALEDKERPFFLTVAPIAPHFEQDPGHSSDTP
FT                   PQAPIPAPRHAHLFPDAKVPRVPSFNPLNQTGPSWIRDLKHQNQSVVDYEDFFYRQRLR
FT                   ALQSVDEMVDKLLDRLERSGQLNNTYVIYSSDNGFHIGHHRLPPGKSTSYEEDIRVPFF
FT                   IRGPGIKSGGKVTQVTTHIDFAPTIFELLGLPPRSDFDGTPMRIMKDSAAIPHEHVIVE
FT                   YWGQALMMVTAPTNTDRMPNTTYKSVRLLSEKYNLFYAVWCTGDHELFDLNTDPYQMHN
FT                   IYNTASRSFKNRLDALLLVLKSCAGSTCIKPWAELHPDGSVQSLSDALDSQYDGFYAQL
FT                   PKVEYEACVDGYLIAAEGLQWEDVSASALRNYVRRNYAFDDVQKYRKL"
     atgaagctca gcagtttggt tgcccttgta ggggtctcgg ccctctccga ggccagccct        60
     aggcctaaac ccaactttgt tttcgtgttc accgatgatc aagacctgac aatgaactct       120
     gtggaatata tgccacatgt cgcaggtcgc attcgggata ggggacttga tttcacaaac       180
     cactttgtaa cgacagcgct ttgctgcccg tcgcgagtca gcctctggac tggtcgccaa       240
     gcgcacaaca cgaacgtcac atgggtcgct ccaccatacg gcggttatcc gaagtttgta       300
     tcacaaggtt tcaacgagga ctggtttccc ctgtggttgc aggatgctgg atacaatacc       360
     tactacgtcg ggaagctatt caatgcgcac agcgtgacga cttacaataa tccatttgtc       420
     aaaggcttca atggctcgga cttcttgctg gacccattca catactctta ctggaactcc       480
     agttatcagc gtaatcatga ggccccaaag agctatgcgg gccagtatac gacggacgtc       540
     accgaagaaa aggctctcgg ctttgtggac gatgctttgg aagataagga acgacctttt       600
     ttcctgactg tggccccaat tgcaccacat tttgagcaag atcccggtca ttcttcggac       660
     actcctccac aagctccgat ccctgctcct cgtcatgctc acctctttcc tgatgctaaa       720
     gttccgcgtg tgccttcttt caacccactc aatcaaactg gtccgagctg gattagagac       780
     ctgaagcacc agaatcaatc ggtggtagac tatgaagact ttttctaccg ccagcgtctc       840
     cgcgccctgc aaagtgtcga cgagatggta gataaactgc tcgaccgcct agagcgcagc       900
     ggtcaactca acaacaccta tgtgatctac agttcggaca acgggttcca tatcggccac       960
     caccggcttc cacctggaaa gtcaacatcc tacgaggagg atatccgtgt accatttttc      1020
     atccgcggac cagggatcaa atccggaggg aaggtaactc aggttaccac tcacatcgac      1080
     tttgctccca ccatctttga gttgctcggg ttgccgcctc gcagtgactt tgacggcact      1140
     ccgatgcgta tcatgaaaga tagcgccgcc attccccatg agcacgtcat agtggagtat      1200
     tggggccagg cactgatgat ggtcacagcc ccgacgaaca cagaccgcat gccaaacacg      1260
     acatataaat ccgtccgcct cctgagcgag aagtacaatc tcttctatgc tgtctggtgc      1320
     actggtgacc acgagctttt tgatctaaat acggacccct accaaatgca caacatctac      1380
     aataccgcct ctcgatcttt caagaacagg ctagacgccc tcctcctcgt cctgaagtcc      1440
     tgcgccggaa gcacatgcat caagccctgg gccgaacttc accctgacgg atcggttcag      1500
     agcctttctg acgctttgga ttcgcaatat gatgggttct atgcccagct tcctaaggtt      1560
     gagtatgagg cttgcgtaga cgggtatctc attgctgcag aggggttgca gtgggaagat      1620
     gtcagtgcta gcgctctacg gaactatgtc cgacggaatt acgccttcga tgatgtgcag      1680
     aagtaccgga aactctag                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page