(data stored in ACNUC16935 zone)

EMBL: BN001307.PE177

BN001307.PE177       Location/Qualifiers
FT   CDS_pept        join(507408..507726,507781..507900,507962..508574,
FT                   508625..509459)
FT                   /locus_tag="ANIA_08903"
FT                   /old_locus_tag="AN8903.4"
FT                   /product="MFS peptide transporter, putative
FT                   (AFU_orthologue; AFUA_8G02550)"
FT                   /note="transcript_id=CADANIAT00007965"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007965"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007965"
FT                   /db_xref="GOA:Q5AS27"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS27"
FT                   /protein_id="CBF84697.1"
FT                   /translation="MNPADSVEIGDAVAAQQNAHLAQLPLGKDIKLEKDAIARESSIEE
FT                   IPATKEYPTGSEEDQDLNKLHPTQEEMQTLRRVAGPMNWITFSVAFVELCERFSYYGTT
FT                   AVFVNFIQQPLPPGSTTGAISGGSEVPGALDMGQQASTGLTLFNSFWSYVMPLAGAFLA
FT                   DQYWGRFRTIMFSIGCALVGHVILIISAIPPVIANPNGAIGCFAIGLIIMGMGTGGFKS
FT                   NISALIAEQYPDERPYLKTLPSGERIIIDPAATVARVYLYFYLCINVGSLTGQISMVYA
FT                   ERYVGFWLSFLLPTIMFCFSPLVLYLCRNKYHLVPPTGSVYTQAYRLIREAIRHHWSVT
FT                   TVKVAGIPFKRIKKNDTHFWNTVKPSTMGANRPTWMTFDDEWVDEVARGLKACRVFLWY
FT                   PLYWLAYNQMLNNLTSQAATMRLGGVPNDIINNFNPLALIIFIPIFDRLLYPFLRRIGI
FT                   KFTPLKRITAGFFVAGSGMIVATVTQHYIYKKGPCGKEANSCLEQGLHAPISVWVQALT
FT                   YILGGISEILASVTSLEYAFTKAPKNMRSLVQAVSLFMNAFSSAIGQAFVGLSEDPLLV
FT                   WNYAVVAILAFVGGIGFWATNYKLDKQEDELNTLAQSKYEGSGLKQDEEAKA"
     atgaacccag ccgattccgt tgagatcggc gacgccgtcg ccgctcagca gaatgctcat        60
     ctcgctcagc tgcccttggg taaagatatc aagttggaga aggatgccat cgccagggag       120
     tccagtatcg aggaaatccc cgcgaccaag gaatatccaa ccggcagcga ggaggaccag       180
     gatctgaaca agctccaccc tacgcaggag gagatgcaaa cgctccgccg cgttgctggg       240
     ccgatgaact ggatcacttt ctctgtggct ttcgtcgagc tgtgcgagcg tttctcctac       300
     tatggaacca ccgctgtttt cgtcaacttc atccaacagc ctctgccccc gggctctacc       360
     accggtgcca tctctggcgg ctccgaggtt cctggcgcct tggatatggg ccagcaggct       420
     tcgaccggtt tgactttgtt caactctttc tggtcgtacg ttatgccact cgccggtgcc       480
     ttcttggcag atcagtactg gggtcgtttc cgaacgatca tgttctcgat cggttgtgcc       540
     ctagtcggtc acgttatcct catcatctcc gccattcccc ccgtgatcgc aaaccccaat       600
     ggcgctattg gctgttttgc gatcggtctg atcatcatgg gtatgggtac cggtggtttc       660
     aagtccaaca tctcggcctt gattgcggaa caataccccg atgagcggcc ctacctaaag       720
     accctaccat caggagagcg catcatcatt gacccagctg ccactgttgc tcgtgtctat       780
     ctttatttct acctgtgtat caacgtcggc tcgcttactg gacagatcag catggtctac       840
     gccgagcgat acgttgggtt ctggctgtca ttcttgctgc ccacgatcat gttctgcttc       900
     tctcctctcg tgctgtacct ctgccgcaac aaataccacc tggttccccc gactggctct       960
     gtgtataccc aggcctatcg tctgatcagg gaagctatca ggcaccattg gtccgttacc      1020
     acggtcaaag tggctggtat tccattcaag agaatcaaga aaaacgatac ccacttctgg      1080
     aacaccgtca agcccagcac catgggagca aaccgtccta cctggatgac attcgatgac      1140
     gagtgggttg atgaagttgc ccgcggtctc aaagcgtgcc gggtgttcct ctggtatccc      1200
     ctgtactggc ttgcctacaa ccaaatgctt aacaatctta cctctcaggc cgccacgatg      1260
     cgacttggcg gcgtccccaa cgacatcatc aacaacttca acccgctcgc cctcatcatt      1320
     ttcatcccca tcttcgaccg cttgctatac cctttcctcc gtcgtattgg aatcaaattc      1380
     acgccgctca agcgtattac agcaggattc ttcgtggccg gttccggtat gatcgtggct      1440
     accgtcaccc agcactatat ctacaagaaa ggcccatgcg gtaaagaagc caacagttgt      1500
     ctggagcaag gcctgcacgc acccatctct gtctgggtgc aggctctcac ctacattctc      1560
     ggtggtattt ccgagattct ggcgtcggtt acatcccttg agtacgcctt caccaaggcg      1620
     cccaagaaca tgcgcagttt ggtccaggcc gtctcactct tcatgaacgc tttctcttct      1680
     gccatcggtc aggcctttgt cggtctttca gaagacccgc ttcttgtctg gaactacgct      1740
     gtcgttgcca tcttggcgtt cgttggcggc attggcttct gggcaacaaa ctacaagctg      1800
     gataaacagg aagatgagct caacaccctt gctcagtcga agtatgaggg ctctggattg      1860
     aagcaggatg aggaggcgaa agcctaa                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page