(data stored in ACNUC16935 zone)

EMBL: BN001307.PE183

BN001307.PE183       Location/Qualifiers
FT   CDS_pept        join(520116..520297,520353..521286)
FT                   /locus_tag="ANIA_08897"
FT                   /old_locus_tag="AN8897.4"
FT                   /product="lipase/thioesterase family protein
FT                   (AFU_orthologue; AFUA_8G02590)"
FT                   /note="transcript_id=CADANIAT00007971"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007971"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007971"
FT                   /db_xref="GOA:Q5AS33"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS33"
FT                   /protein_id="CBF84708.1"
FT                   /translation="MLTIAQKLDYIPALASVAVTFVWALLTVAIRAPEYPSHWLLHVGY
FT                   AVFRKLTARLSAAQMQYVLPASNLVYNRYIRSVRQKPLTVQLEHGAMGHWIGDPKAKNI
FT                   LVWYHGTSRLLAHNPPGVLTEAGGGFALPANIGYFKFFASIVADCERNGQSLAVFALTY
FT                   TLAPVATYPTQLRQAVEALRYILVEKRHSADHVMLGGDSAGGNLVGGVLSHLSHTHPAI
FT                   DPLPLDGAALAGAVMIAPWTQLQPELGDRIIDSRGDLITPAVGPLWGSGYVGEAPKDFY
FT                   TDLSDAPVEWFAKFPVRKILVCGGEREILLPVIEDFVEKLRKGFKGDVEFCVGKGEGHV
FT                   APVYNLYIGDKRETQQGARAKSFIRGLLEKM"
     atgctcacga tcgcgcagaa actcgactac atccccgcgt tggcgtctgt tgcggtgacc        60
     tttgtgtggg cgctgttgac ggtcgccatc cgcgcgcctg agtatccttc acactggctg       120
     ctgcacgttg gctacgcggt cttccgcaaa ctgacggcgc gtctgtcggc ggcccagatg       180
     caatatgttc tccccgccag caacttggtg tacaaccgct acattcgctc tgtgcgacag       240
     aagcccctga ccgtccagct ggaacatggc gccatgggcc actggattgg tgatcccaag       300
     gctaagaaca tcctggtctg gtatcacggt acgtctcgat tacttgctca taatcctccg       360
     ggtgtcctaa cagaggcagg cggcggtttt gctctccccg caaacatcgg ctatttcaag       420
     ttcttcgcca gcattgtcgc cgactgtgaa cgcaacggcc aatcgctcgc tgtgttcgcc       480
     ttgacgtaca ctctcgcccc ggtggctacc tatcccaccc agctacgaca agccgtggag       540
     gctcttcggt acatcctcgt cgagaagcgc cactctgcgg accatgtcat gctcggtggc       600
     gactcagcgg gtgggaatct ggtcggcgga gtcctgtcgc atctttcgca tacccacccc       660
     gccattgacc ctctccctct cgacggcgcc gccctcgctg gagccgtcat gattgcaccg       720
     tggactcaat tgcagcccga gctcggcgac cgcatcattg actctcgcgg cgatttgatc       780
     actcccgccg tcggaccgct ttggggaagc gggtatgtcg gcgaagctcc gaaggatttc       840
     tatacggacc tatcggatgc gccagtggaa tggtttgcca agttccccgt tcgtaagatt       900
     ctggtttgtg gcggtgagcg cgagatcctt ctaccggtca ttgaggactt tgtggagaag       960
     ttgcgcaagg gatttaaggg ggatgtggag ttttgtgttg gcaagggtga aggtcatgta      1020
     gcgccggttt ataatctata tataggggat aagagagaga cgcagcaggg ggcgagggcc      1080
     aagtcgttta ttagggggct gttggagaag atgtag                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page