(data stored in ACNUC16935 zone)

EMBL: BN001307.PE186

BN001307.PE186       Location/Qualifiers
FT   CDS_pept        join(525301..525447,525583..525819)
FT                   /locus_tag="ANIA_11150"
FT                   /old_locus_tag="AN11150.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007974"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007974"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007974"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLS4"
FT                   /protein_id="CBF84713.1"
FT                   /translation="MKKGKRMKKTIIMKTALASLITAYVPAECTRPESMNERDPTRNLR
FT                   REAGSGPKNIPPRTENGWVHPRICSQPRRNDVQTAYGEQCDSGPDAIDKSVAGYPARGR
FT                   QQKSADKLFACLWGDVVLEAKVI"
     atgaaaaaag gcaagaggat gaagaagacc atcatcatga aaacggcatt ggcgtctctg        60
     ataacagcat acgtccccgc ggagtgtacg aggccggaaa gtatgaacga gagagatccc       120
     actagaaatc tgcgcagaga agctgggtcg gggccaaaga atataccgcc acgaaccgaa       180
     aatggatggg tacatccacg gatctgcagc cagcctcggc gaaacgacgt acagaccgcc       240
     tacggcgagc aatgcgatag cggccctgat gccatcgaca aatccgtagc aggctaccca       300
     gcacgcggga ggcagcagaa atcggcggat aaactcttcg cttgtctctg gggagatgtg       360
     gtattggaag ccaaggtgat ttaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page