(data stored in ACNUC16935 zone)

EMBL: BN001307.PE188

BN001307.PE188       Location/Qualifiers
FT   CDS_pept        join(530252..530444,530577..530635,530692..530752,
FT                   530799..531037)
FT                   /locus_tag="ANIA_08893"
FT                   /old_locus_tag="AN8893.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007976"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007976"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007976"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS37"
FT                   /protein_id="CBF84717.1"
FT                   /translation="MTKIALFGSTGQICRAILLALLTTTPHEIASIDQPSSENKAKEID
FT                   VCEEEKKRLKTAGINILEAVGYGMHLLHTDENGRGVLHPTWNIKEDGNRKALHHPPISA
FT                   GQRASLVSLDPAGRAVYTLHILGDADAAVDFTHIDNLAAFVVFTIDSPDVAGNKSLNIV
FT                   SDRISYNELTTLLEKYSKKK"
     atgacgaaaa ttgctctctt cggctccacg ggccagatat gccgggccat tctgttggct        60
     ttgcttacta cgacaccaca tgagatcgcc tcaatcgacc aaccttcatc cgaaaacaag       120
     gcaaaagaga tcgatgtctg tgaagaggag aagaaacgcc tcaagactgc tgggatcaat       180
     atattggaag cagtcggata tggcatgcac ctgcttcaca cagatgagaa cgggcgtgga       240
     gttctacacc ctacatggaa cataaaggaa gatggcaacc gcaaagccct tcatcaccca       300
     cccatttctg cgggacagag agccagtttg gtgtccctgg acccagctgg acgcgccgtc       360
     tataccctgc acattctagg cgatgctgat gcggctgtcg acttcacaca tattgataac       420
     ctcgccgcat tcgtagtatt cactattgac agccctgatg ttgcgggaaa caagtcgcta       480
     aacatcgtca gtgaccgtat cagctacaac gagctgacca ccttattaga gaagtactca       540
     aagaagaagt ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page