(data stored in ACNUC16935 zone)

EMBL: BN001307.PE193

BN001307.PE193       Location/Qualifiers
FT   CDS_pept        547358..547777
FT                   /locus_tag="ANIA_08888"
FT                   /old_locus_tag="AN8888.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007981"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007981"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007981"
FT                   /db_xref="GOA:C8VLT1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT1"
FT                   /protein_id="CBF84726.1"
FT                   /translation="MSYYNALIRTHHITSRKKVSALKRAADSLNVFALLRSGGCPGIMY
FT                   IEAKDKDAVESWVSVVRNLRYKDFQLVSRPACVVIEEDFMKVEGKQKNDAQRRGKAFLD
FT                   AGLEEVESVKEFGDLMAQRGVWQWWRKRMGYVRGD"
     atgtcatact acaacgctct catacgcact catcacatca cctctcgaaa aaaggtctcc        60
     gccctaaaac gcgccgccga ctctcttaac gtttttgctc tcctccgctc cggcggctgc       120
     ccgggaataa tgtacatcga ggcaaaggac aaggacgctg tcgagtcgtg ggttagcgtg       180
     gttcgaaatc tgcggtataa ggactttcag cttgtgagtc ggccggcttg cgtggtaatt       240
     gaggaggatt ttatgaaggt ggaggggaaa cagaagaacg atgcccaaag aagaggaaag       300
     gcgttcttag atgctgggct ggaggaggtg gagagtgtca aagagtttgg ggacttgatg       360
     gcgcagaggg gggtttggca gtggtggagg aagaggatgg ggtatgttcg cggagattga       420
//

If you have problems or comments...

PBIL Back to PBIL home page