(data stored in ACNUC16935 zone)

EMBL: BN001307.PE196

BN001307.PE196       Location/Qualifiers
FT   CDS_pept        complement(join(551069..551320,551425..553587))
FT                   /locus_tag="ANIA_08886"
FT                   /old_locus_tag="AN8886.4"
FT                   /product="repressor protein (AFU_orthologue; AFUA_8G02700)"
FT                   /note="transcript_id=CADANIAT00007983"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007983"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007983"
FT                   /db_xref="GOA:Q5AS44"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS44"
FT                   /protein_id="CBF84731.1"
FT                   /translation="MPHCSGADVYRRVDPEASLVLIGIRGCGKRSLGFVAATALKRRFI
FT                   TEDHYFKEVTGLSRHEYLKQHGSQNFQQRDIEVLKLMLDNHRSRCVIECGLGTLTRPVQ
FT                   EYLRQYSLTNPVVYIARDMDRIQKLLGFDDQAAKLLCEGDPLHRTCSNFEYYNAEDRSS
FT                   FAQLDEETQDRRSVVYSFKLKEAKEDFTRFVRFVTGTDVGHSSYDSPFVLLETPPELRS
FT                   YTYAIFVRSSDMIDNRVRLSELESGGDAIELCVDRWGPNMAMTVSKQVSILRRNTHAPI
FT                   ILSIDTRSLGITGGDQYPIKGSNVYAQIVEHCLRLAVEYLVVDLDQDQALINETIRNRG
FT                   MTKIIGQRIFEPSSGVSWDNEECLSAYLNAAGLGCQLVRILRVATEREDNAAIAKFTNR
FT                   IELLPGDHPPVIAFNLGSLGRTSQVFNSILTSVSHSAIDRLSHNERDPQIMARDAVQAL
FT                   FQSYVLDPLQFYILGGSVAYSLSPAMYNAAFRHCGMNHTYSIPEKPTLAALDELGRDPN
FT                   FGGASIVQPWRVQVFQKLAAKSRHAEAIGAINTIMPLRGHSDGTMFPLQEQASRRHLAG
FT                   PVLGWYGENTDWVGIMTCINRNLSPRNAISPSRTTGLVIGAGGMARAAIYAMLRLGCRK
FT                   IFIYNRTLSRAETVARHFNSWAASQVGSTEVVYVLRSLHEEWPQDACPPCMVASCVPAD
FT                   PDRDEPPANFEMPTQWLGSPTGGVVLEFAYKPLETPLLRQMRRFRSETGRQWELVDGLD
FT                   NVAEQAIAQFEILTGRKAPRRLMTMEALRNYAGENGPFDEKTIRARINIYE"
     atgcctcatt gttccggcgc agatgtatac cgcagggttg acccggaggc atccctggtc        60
     ctcattggga ttcggggatg tgggaaacgg tcactggggt ttgttgctgc tacagcgttg       120
     aagcggcgtt tcatcacgga ggaccactac tttaaagaag ttactggact ttcgcgccac       180
     gagtacctga agcagcatgg aagccagaat ttccagcagc gagatattga agtcctcaaa       240
     ttgatgctag acaaccaccg ttcgcgctgc gttattgagt gcggcttagg aactcttact       300
     cgtcccgtcc aggaatacct tcgacagtat tctcttacga accccgtggt gtacattgcg       360
     cgagatatgg atcgcattca aaagttgcta ggatttgatg atcaggcggc aaagctactt       420
     tgtgaaggcg atccgctaca ccggacttgc tcaaattttg agtactataa cgcggaggat       480
     cgctcgagtt tcgctcagct cgacgaagaa acgcaagatc gacgttcagt cgtctattct       540
     ttcaaactca aggaggcgaa ggaggatttc acacgtttcg ttcgcttcgt cacgggtaca       600
     gacgtcggcc attctagcta tgactcgcct ttcgtgctgc tcgaaactcc acccgagcta       660
     cggtcgtaca cctatgcgat ctttgtccgt tcctccgaca tgatcgataa cagagtcaga       720
     ttatcagaac tcgagtccgg tggggatgct attgagctgt gtgtcgatcg ctggggccca       780
     aatatggcga tgactgtgag caagcaggtt tctatcctca ggagaaatac gcacgctccg       840
     ataattctgt caatcgacac ccgctcgctt gggattactg gtggcgatca atacccgata       900
     aagggcagta atgtgtacgc tcagattgtg gaacactgcc tacggcttgc cgtcgagtat       960
     ctggtggtcg acctggatca agatcaggcg ctaatcaatg aaaccatccg taataggggc      1020
     atgacaaaaa tcatcggtca gcgtattttt gaaccgtcct ctggtgttag ttgggataat      1080
     gaagaatgcc tatcggctta tctcaatgct gctggactgg ggtgtcagtt ggttcgcatt      1140
     ctgcgtgtag caacggagcg cgaagacaat gcagccattg ccaaattcac taataggatt      1200
     gaattgttac cgggtgacca cccaccggtt atagccttca acctcggtag ccttggccgc      1260
     acctctcagg tattcaactc tattctcacc tctgtgtcgc attctgcaat cgatcgtctt      1320
     tctcacaacg agagagatcc gcaaatcatg gcccgtgacg ctgttcaagc tcttttccag      1380
     agttatgtcc tggatcctct gcagttctat atcctgggcg gcagcgtagc ttacagtcta      1440
     tcgcctgcga tgtataacgc cgctttccgc cattgcggta tgaatcatac ttatagtatt      1500
     ccggaaaagc caacattggc agcattagac gaactgggtc gagatccgaa tttcggtggc      1560
     gccagtattg ttcaaccttg gagggtgcaa gtcttccaga agctcgcggc aaagagccgc      1620
     catgccgaag ccataggtgc aataaataca atcatgccac ttcggggtca ctcggatgga      1680
     actatgttcc ctctacaaga acaagctagc cgccgccatc tggctggtcc agtgctggga      1740
     tggtatggcg agaatacgga ttgggttggt attatgacct gcatcaaccg caacctctcc      1800
     ccgcgtaatg ctatcagccc gtccaggacc accggcctgg tcatcggagc cggtggtatg      1860
     gcgcgtgccg ctatatatgc tatgcttcga ctcggttgtc gaaagatttt catctacaac      1920
     cggactttat cccgcgcaga gaccgtcgct cgccatttca attcatgggc cgcctcccaa      1980
     gtgggctcca cggaagtagt gtatgtgctt cggtcgctgc acgaagaatg gccgcaggat      2040
     gcctgccctc cgtgcatggt cgcctcttgc gttccagcgg acccggacag agatgagccg      2100
     ccagctaatt tcgaaatgcc aacgcagtgg ttgggaagcc caaccggtgg agtagtcctt      2160
     gagtttgcgt acaaaccgct ggaaacgcca ctgcttcgcc agatgcgtcg ctttcgtagc      2220
     gaaactggac gtcaatggga attggtagac ggccttgaca atgttgctga gcaggccatt      2280
     gcgcaattcg agatattgac tggacgaaag gcgccgcgcc gattaatgac catggaggcg      2340
     ctccgcaact atgccggtga aaatggaccg ttcgacgaga aaacaattcg agctcgcata      2400
     aacatctacg aatga                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page