(data stored in ACNUC16935 zone)

EMBL: BN001307.PE198

BN001307.PE198       Location/Qualifiers
FT   CDS_pept        complement(join(558286..558621,558677..559612))
FT                   /locus_tag="ANIA_11144"
FT                   /old_locus_tag="AN11144.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007985"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007985"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007985"
FT                   /db_xref="GOA:C8VLT5"
FT                   /db_xref="InterPro:IPR003378"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT5"
FT                   /protein_id="CBF84735.1"
FT                   /translation="MRKDWAFSDNSGATTDWQIKNVTNAPKYDNMTACAHLPGMDKVLV
FT                   ILKTGATEALDKIPVHLRTTLECVQHYVIFSDFEEYIYGVHVQDVLRSVSEGMKQTNSD
FT                   FGIYNRLRASGRGGLTADDWRDDENGPLGKQGNPGWKLDKWKFVPMIDEALLASPWAHW
FT                   YVFLEADTYIVWRNMVRWLSQLDQRKALYLGAPMQMGSQIFAYGGAGIVLSRTAMRLIS
FT                   QYRAQNFTVVEQMTADDWAGDHVLGRILGDIGVPLIWSWPLLVPSSIWEFEYFTKAYGR
FT                   QPWCYPAVSFHHMSTQDIWDMWLLEQQWFKYQVDVPLLHKDIFNWKLYDAISSMKDDWD
FT                   NISSDQQPRNISDSPTTSEECKQRCSLITDCLQFSFSHEGCRTSKKVVGGVPRPGFHSG
FT                   WVATRIKALIKNAGRCSKAQYITG"
     atgcgcaagg attgggcctt cagtgataat tctggcgcca ccacggactg gcagatcaag        60
     aacgtgacaa atgcgcctaa gtacgataat atgacagctt gcgcccatct acccggtatg       120
     gataaagtcc tagtcatctt gaaaacaggc gctaccgaag ctttggacaa gatccccgtg       180
     catttaagaa caacgctgga atgcgtacag cactatgtca tcttctcaga cttcgaggag       240
     tatatctacg gagtgcatgt ccaggatgtt ctgcgcagtg ttagcgaagg catgaagcaa       300
     acgaactcgg actttggtat ctacaatcgt ctacgtgcat ctgggcgtgg tggtctcact       360
     gcagatgact ggcgggacga tgagaacggc ccccttggga aacagggaaa cccaggatgg       420
     aaacttgata agtggaaatt cgtgccgatg attgacgaag cactgcttgc gagcccctgg       480
     gctcattggt acgtctttct cgaagcagat acgtacatag tttggcgaaa tatggtccgt       540
     tggctgtcac aactggacca gaggaaggca ttatatcttg gggctcccat gcaaatggga       600
     agtcagatat ttgcctacgg tggcgcagga atagtgctct ctagaactgc catgcggtta       660
     atatctcagt atcgtgccca gaacttcacg gtcgttgagc agatgaccgc ggatgattgg       720
     gctggagacc acgtgctggg ccgaatcctt ggtgacatcg gtgtaccact tatctggtca       780
     tggcctctgc tggttccatc tagcatatgg gagtttgagt actttaccaa ggcttatggt       840
     cgtcagccct ggtgctatcc agccgtctca ttccaccata tgtctacgca agatatctgg       900
     gatatgtggt tgcttgagca gcagtggttc aaataccagg tagacgtgcc gttgttgcac       960
     aaggatatat tcaactggaa attatacgat gcgataagct ccatgaagga cgattgggac      1020
     aatatctcct cagatcaaca accacggaat atcagtgatt caccaactac cagtgaagaa      1080
     tgtaaacaaa gatgctctct gatcacagac tgtcttcaat tttcgttctc gcatgaaggg      1140
     tgccggacct ctaaaaaagt tgtcgggggt gttcctcggc caggatttca ttctggctgg      1200
     gtggccacgc gaatcaaggc gctcataaaa aatgcaggga gatgttcaaa ggcacagtac      1260
     atcactggat ag                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page