(data stored in ACNUC16935 zone)

EMBL: BN001307.PE2

BN001307.PE2         Location/Qualifiers
FT   CDS_pept        complement(join(4058..4094,4350..5323,5610..5684,
FT                   5717..5769,5842..6011,6229..6584))
FT                   /locus_tag="ANIA_09484"
FT                   /old_locus_tag="AN9484.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007794"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007794"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007794"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQE6"
FT                   /protein_id="CBF84373.1"
FT                   /translation="MPRQHSCLKPRLGDIPFQVVTQRPSCRPCTSRRPLSQPEAWVIIR
FT                   VSLSGSPKAIEQDDDILDSVVERQPEMGGHFVARITDKDNAAKAPIRDDSLIQVRQAGP
FT                   QHPRPNILDRDLECQRGGFYHCLLWIVLQGNVVHDPTGPAVNAIGTNGKGPVEHAAVGA
FT                   GHTDYVLGGCDRAQPGESDWVSRLTGNDVGKEENKEQQLLCHPPRIRGLCAPSAFSRIP
FT                   ALYSITAAQTLPPTDENPISGYYISSFLTTTAGNQYYVITAIIGTTELGAYGINILDLN
FT                   TLQRVVYENTTVYSTTEITSFNFTREDFAFFGADSTNLAIAVRANATASRGDGTTVPVG
FT                   LELLVHATSRALYYGGTGSWMFIDTPAYSFAFPAAMTSGCLRMSLSDLSMANKEDADAA
FT                   TTLQPIDPSASVSWYDRSWGHLGLPNGNYTWFSLYLDDSELILVTYLIDDSSTSASSSR
FT                   THRHTHSRSIHIRPRRNSSALSLEPIDVFEPDLSPDTIWMSPRSGRVYPQQWKLGIEGR
FT                   GLLSIRSILGDQEMFGRGQGGESYSGLTQSPAEQPAG"
     atgccgcgcc agcattcttg tctcaagccc agactagggg acatcccctt tcaagtggtg        60
     acgcagaggc catcctgtcg gccttgtacc tctcgaagac ccctttcaca gcctgaggct       120
     tgggttatca ttagggttag cttgagcggc tccccgaagg ctattgaaca ggacgacgac       180
     atcctggatt ctgtagttga gcgacagcct gaaatgggtg gtcattttgt ggcacgaatc       240
     actgacaagg ataatgcggc caaggctcca atacgtgatg attcactcat ccaagttcgt       300
     caggctggcc cacagcatcc gcggccaaac atacttgacc gtgaccttga gtgtcagcgc       360
     ggagggtttt accattgttt gctgtggatt gtcctacaag gcaatgttgt gcatgatccg       420
     acaggtcctg ctgtaaacgc catcggcacc aatggtaaag gacccgtgga acacgctgcc       480
     gtcggcgcag gtcacactga ctacgttttg ggtggttgtg atcgcgctca gcccggtgaa       540
     agcgactggg tctcaagatt gaccggtaat gacgtgggga aagaggagaa caaggagcag       600
     caattgctgt gccacccacc taggattaga ggactctgcg caccctcggc cttttctcgt       660
     atccctgccc tctacagcat taccgctgcc caaacccttc ctccaaccga cgaaaaccct       720
     atatcaggct actatatctc ctccttcctc accacaaccg ccggaaacca gtactacgtg       780
     attacagcca ttatagggac tactgaattg ggcgcgtacg gcattaacat cctagacctc       840
     aacaccctcc agcgcgtggt ctacgaaaac acgactgttt actcgactac cgaaataaca       900
     tccttcaatt tcaccagaga agactttgcc ttctttggtg ctgactcgac caatcttgct       960
     attgctgtgc gcgccaatgc aactgcctcc cgtggggacg gaactacggt gcctgtgggc      1020
     ctcgaactac tcgttcatgc tacctcgcgc gcgttatact acggcggtac gggctcgtgg      1080
     atgttcatcg atacccccgc atacagcttt gcttttccgg ctgcaatgac gtctgggtgt      1140
     ttacgcatgt ctttgtctga tttatcaatg gccaacaagg aagatgcaga cgcagccacg      1200
     accctccaac ccatagaccc gtctgcgtcc gtctcctggt acgaccgttc ctggggccat      1260
     ctgggcctcc ctaacggaaa ctacacctgg tttagcttgt accttgacga cagtgagctc      1320
     atccttgtca catacctgat tgatgacagc tccacctctg cttcaagctc ccgcacgcac      1380
     agacacacgc acagccgaag cattcacatc cgaccccgcc gcaactctag cgcattatcg      1440
     cttgagccca tcgacgtgtt tgagccggac ctatctccgg acaccatttg gatgtcgcca      1500
     cgctcagggc gcgtgtaccc gcagcaatgg aaactgggaa ttgaggggag ggggttgctg      1560
     agcatacgga gtatactcgg tgaccaggaa atgtttggtc ggggacaggg tggggagagt      1620
     tattcggggc tgacccaaag cccggcggag caacccgctg ggtag                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page