(data stored in ACNUC16935 zone)

EMBL: BN001307.PE20

BN001307.PE20        Location/Qualifiers
FT   CDS_pept        complement(57704..58591)
FT                   /locus_tag="ANIA_09041"
FT                   /old_locus_tag="AN9041.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007811"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007811"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007811"
FT                   /db_xref="GOA:C8VKQ7"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKQ7"
FT                   /protein_id="CBF84406.1"
FT                   /translation="MDLTQIRRHHWTTSITYDASNIITYNLSVGSKGQDLRHCWEEHPE
FT                   FQALPTFSSLAVIDIMGKVTVDMPKLLPLYKPSQHPHVHAEHSLEIRGPLPRSGTLTSE
FT                   ARILDVVDRRTGVALIVGISIRNEDTGEWICYSEWTSFLMKMPGDGASKASSSMQSTLL
FT                   PSREPDAVLSHQTTPEQGALYRAATGEWNPMHIDPATAQRAGFPGPILSGTCTIGIGVN
FT                   HVIEAFAGGDSARFQRLKLRLSKPVFPGEVVTTKMWRFNETKIVYQQVAGDGRVVISNA
FT                   EIKLKAGGKQRSQL"
     atggacctca cccagataag acgccaccat tggaccacct caatcaccta tgatgccagt        60
     aatatcataa catacaatct atccgtcggc agcaaaggtc aagatctccg tcactgctgg       120
     gaagagcatc ccgagtttca agccctgccg acgttcagct cgctagctgt gatcgacatc       180
     atgggaaaag tcactgttga catgccgaaa ctcctgccac tatataagcc gagccagcac       240
     ccgcatgtcc acgcagagca ttctctcgag ataagagggc cattgccaag atcgggaact       300
     ctaacctctg aggcgaggat tcttgacgtt gtcgatcgtc gcacgggcgt cgctctgatt       360
     gtgggtattt caatcaggaa tgaggatacg ggggagtgga tttgctatag cgagtggacc       420
     tcttttctga tgaagatgcc aggagacggg gcgtcgaagg cttcttcgag tatgcagagt       480
     acactacttc ctagccgaga gcccgacgcg gtgctcagcc accagacaac ccctgaacaa       540
     ggtgctctgt atcgagcggc aacaggcgag tggaatccaa tgcatattga tcctgcgact       600
     gcccagcggg ctggcttccc aggccctatt ctctctggga cgtgtacgat cgggattggc       660
     gtaaaccatg ttatcgaggc ctttgctggt ggagattcgg cgcgattcca gagactaaag       720
     ctgagactta gcaagcctgt ctttcccggg gaggtagtca caaccaagat gtggcggttt       780
     aacgaaacga agattgttta tcaacaggtg gcgggggatg ggagggttgt catttcgaat       840
     gcggagatta aactgaaagc tggaggaaag cagcggagcc agttgtaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page